ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_016600 (APE)

DNA-(apurinic or apyrimidinic site) lyase, putative, a gene from Toxoplasma gondii

Compiled localisation
cytoplasm and nucleus during intracellular tachyzoite

Who localised this protein by microscopy?

Onyango, D. O., Naguleswaran, A., Delaplane, S., Reed, A., Kelley, M. R., Georgiadis, M. M., Sullivan, W. J. Jr
Base excision repair apurinic/apyrimidinic endonucleases in apicomplexan parasite Toxoplasma gondii. (2011 May 5, DNA Repair (Amst)) PubMed / full text
   more detail about this publication

cytoplasm and nucleus during intracellular tachyzoite
  • "Native TgAPE is present in the parasite nucleus and cytoplasm while native TgAPN is nuclear (Fig. 2B)."
  • Microscopy type: fixed light
  • Microscopy method: antibody directly to protein, FLAG tag
  • Strain: RH
  • Gene model mapping comments: blast from HM593513, taken directly from publication
  • Localisation record: nucleus and cytoplasm during intracellular tachyzoite
  • Comment: GenBank sequence not yet released, even though the article is fully published
  • Other genes localised in this publication: endonuclease V, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10227

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PFC0250c AP endonuclease (DNA-[apurinic or apyrimidinic site] lyase), putative
  • PBANKA_040410 AP endonuclease (DNA-(apurinic or apyrimidinic site) lyase), putative
  • PY02645 putative AP endonuclease-related
  • PVX_119405 AP endonuclease (DNA-[apurinic or apyrimidinic site] lyase), putative
  • PCHAS_040500 AP endonuclease (DNA-(apurinic or apyrimidinic site) lyase), putative
  • PKH_083430 AP endonuclease (DNA-[apurinic or apyrimidinic site] lyase), putative
  • NCLIV_059670 hypothetical protein
  • cgd2_40 conserved hypothetical protein
  • Chro.20012 dna-(apurinic or apyrimidinic site) lyase
  • CMU_009970 endonuclease/exonuclease/phosphatase family protein
  • TA02660 endonuclease, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_016600 DNA-(apurinic or apyrimidinic site) lyase, putative
MRPLGSFLPSFVHFDWTFCRGLPLAENLPVSKVTLRRLEPPFASSLAVYSPSALSLSSPPFCLILPASLSGSSAFSSSRS
RPGPQPSPAAAGARTRNSQRTSTMSVHRAVNSAQGEEETEGPHRETTTELNSSAASLSSSPSSAPSCSVSTSAMLQRASD
SSSSGAPPVDLNPSRETRETEEDGEGELERRTEGPKRKAPLSIVTWNVNSIAARIRDSRQWFYFSRFLQKIDPDILCLQE
VKLAAHGPPGAKRGDGMPRDHGRIKDSDKVSSVEARELREALHTLLPNHSLLISLADWRYSGQMMFIRKDVQVCSLRYNL
SLDGCPAHEHDFEGRVILAEFEAFCVLTTYSPNNGATPKSFERRRLWDERMLQFVTQCSSSPHCEGLPVQLLKKPLVWVG
DLNCAPEDIDLSDPDQFRSVIHETADGTIDPDNIGQAGCTDAERRRFRAILERGNLVDAFRELHPRTEPPPLESAEYSWR
GFGGSGSRGLLRGLGMRLDHIVLTETLMPAVELVRICGAGKSKANFFGSDHCPVLVLFKEKEISALPAVVCEALRSSAPA
PAAKKRQDDCRLDSFFAVKRRAQLPGAADQKRKKPEEVVISDSSDEERKTSQKIALHASLEKPRNVQASS

Gene-Specific Links for TGME49_016600

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins