ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_016000 (IMC3)

inner membrane complex protein IMC3, a gene from Toxoplasma gondii

Compiled localisation
daughter cytoskeleton during tachyzoite budding
lower basal levels of cytoskeleton during fully mature tachyzoite
inner membrane complex during intracellular tachyzoite

Who localised this protein by microscopy?

Anderson-White, B. R., Ivey, F. D., Cheng, K., Szatanek, T., Lorestani, A., Beckers, C. J., Ferguson, D. J., Sahoo, N., Gubbels, M. J.
A family of intermediate filament-like proteins is sequentially assembled into the cytoskeleton of Toxoplasma gondii. (2011 Jan, Cell Microbiol) PubMed / full text
   more detail about this publication

daughter cytoskeleton during tachyzoite budding, lower basal levels of cytoskeleton during fully mature tachyzoite

Gubbels, M. J., Lehmann, M., Muthalagi, M., Jerome, M. E., Brooks, C. F., Szatanek, T., Flynn, J., Parrot, B., Radke, J., Striepen, B., White, M. W.
Forward genetic analysis of the apicomplexan cell division cycle in Toxoplasma gondii. (2008 Feb 8, PLoS Pathog) PubMed / full text
   more detail about this publication

inner membrane complex during intracellular tachyzoite
  • "Immunofluorescence analysis of V-A15 using an anti-serum against the inner membrane complex marker IMC3 [25]: "
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: inner membrane complex during intracellular tachyzoite
  • Other genes localised in this publication: proliferating cell nuclear antigen 1, membrane skeletal protein IMC1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_25055

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_016000 inner membrane complex protein IMC3
MSDAGTPPAVQGELSQPQERVEVVVQPISESPDASSEAEQAGVAAGAFHAEVPYPYPPVSTGMPAPEQPAEMHLPANGQL
PEIAEGAETEGLAPVARPPPQVMTALGPMPLPPEVRQKIPEKFVAKPIVEEREIYVSKKEVRERTIEVPHVHYEHKFAEV
ARSLKIKKLVPRVREVVKEIPREVYKPVIEEKVIEVPQGVKYVEVPVEVPCLYPPKIVPKPKVQVIERIVETIKPVVKEK
IVEVPQTVVKQIPKIKTVEVPYYVPRYVEKVIEIPYQPPDAATLPPLMVGGLPSRVSATMPTPFQLGPAPAGHANEVNLP
FEARVDVTVSQSPAGPHSPLSASPQTGTAASLKLGRPATTLVNPDRSAPAIDLPEGFTWGPPPNAPPGTFPAPAMPGLPG
AAGLPVGAADGLNMPPMMITCPPEVGNVKFAGFLADPDILTRRGVMAYQGFKKEGTFQMLFPPLAPQPGIPLDQTGAPDV
NTIVSVNEQMAGQSRHHLIEDLQQQVESEFDQKVNASAMSCTPWASPAVQEREVVYEQ

Gene-Specific Links for TGME49_016000

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins