ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_015980 ()

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
dense granule during extracellular tachyzoite
distal end of parasitophorous vacuole during intracellular tachyzoite

Who localised this protein by microscopy?

Zhou, X. W., Kafsack, B. F., Cole, R. N., Beckett, P., Shen, R. F., Carruthers, V. B.
The opportunistic pathogen Toxoplasma gondii deploys a diverse legion of invasion and survival proteins. (2005 Oct 7, J Biol Chem) PubMed / full text
   more detail about this publication

dense granule during extracellular tachyzoite, distal end of parasitophorous vacuole during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_116023

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_015980 hypothetical protein
MSCQQRLAVVQGSLFCTMKMGRHVVILACFAALASTVAHGLYRSPSYWNDPWPETGEDWAEVVAQVKTTSERLYESVLAF
RRLTTSATVRYSAYKKEKQLRPEALQLPHMWHVRNEIWRITDDLRNAKDQLRLLIRKQKALISILEGMRGKGDRKHWNDT
TSICRKASGELREAEELVEREEEEYNIEVE

Gene-Specific Links for TGME49_015980

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins