ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_015780 (ROP2/3/4, ROP2, Tg3, Tg4, Tg34)

Rhoptry kinase family protein ROP2A (incomplete catalytic triad), a gene from Toxoplasma gondii

Compiled localisation
rhoptry during extracellular tachyzoite and intracellular tachyzoite and mature schizont merozoite and merozoite and tachyzoite
evacuole and parasitophorous vacuole membrane and parasitophorous vacuole during tachyzoite invasion

Who localised this protein by microscopy?

Parussini, F., Coppens, I., Shah, P. P., Diamond, S. L., Carruthers, V. B.
Cathepsin L occupies a vacuolar compartment and is a protein maturase within the endo/exocytic system of Toxoplasma gondii. (2010 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

rhoptry during tachyzoite

Jan, G., Delorme, V., Saksouk, N., Abrivard, M., Gonzalez, V., Cayla, X., Hakimi, M. A., Tardieux, I.
A Toxoplasma type 2C serine-threonine phosphatase is involved in parasite growth in the mammalian host cell. (2009 Oct, Microbes Infect) PubMed / full text
   more detail about this publication

rhoptry during tachyzoite
  • "No clear overlap between TgPP2C (green) and rhoptry resident proteins (Rhop2-3-4, red) was observed indicating that the anti-TgPP2C antibodies did not detect the rhoptry PP2C-hn (Fig. 2A, lower panel)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: RH HXGPRT
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during tachyzoite
  • Other genes localised in this publication: serine-threonine phosophatase 2C, histone H4, putative

Chen, Z., Harb, O. S., Roos, D. S.
In silico identification of specialized secretory-organelle proteins in apicomplexan parasites and in vivo validation in Toxoplasma gondii. (2008, PLoS One) PubMed / full text
   more detail about this publication

rhoptry during tachyzoite

Igarashi, M., Kano, F., Tamekuni, K., Kawasaki, P. M., Navarro, I. T., Vidotto, O., Vidotto, M. C., Machado, R. Z., Garcia, J. L.
Toxoplasma gondii: cloning, sequencing, expression, and antigenic characterization of ROP2, GRA5 and GRA7. (2008, Genet Mol Res) PubMed / full text
   more detail about this publication

rhoptry during tachyzoite
  • "The present study cloned genes from two secretory organelles from T. gondii, dense granules and rhoptry. Analysis of sequence variation in the T. gondii rop2-, gra5- and gra7- coding regions from Londrina-RH strain showed some heterogeneity in nucleotides and predicted amino acid sequences (data not shown), when compared to the RH strains from the GenBank. However, this heterogeneity neither changed reactivity in the indirect fluorescence antibody test nor immunoblotting to T. gondii tachyzoites."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from Z36906, annotation matches
  • Localisation record: rhoptry during tachyzoite
  • Other genes localised in this publication: dense granule protein 5 precursor, dense granule protein 7

Gilbert, L. A., Ravindran, S., Turetzky, J. M., Boothroyd, J. C., Bradley, P. J.
Toxoplasma gondii targets a protein phosphatase 2C to the nuclei of infected host cells. (2007 Jan, Eukaryot Cell) PubMed / full text
   more detail about this publication

evacuole
  • "The evacuoles are identified by ROP2 staining (arrow)"
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RHhpt
  • Gene model mapping comments: Taken directly from 16002398
  • Localisation record: evacuole
  • Other genes localised in this publication: hypothetical protein, hypothetical protein

Zhou, X. W., Kafsack, B. F., Cole, R. N., Beckett, P., Shen, R. F., Carruthers, V. B.
The opportunistic pathogen Toxoplasma gondii deploys a diverse legion of invasion and survival proteins. (2005 Oct 7, J Biol Chem) PubMed / full text
   more detail about this publication

rhoptry during extracellular tachyzoite

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

rhoptry during mature schizont merozoite

Ngo, H. M., Yang, M., Paprotka, K., Pypaert, M., Hoppe, H., Joiner, K. A.
AP-1 in Toxoplasma gondii mediates biogenesis of the rhoptry secretory organelle from a post-Golgi compartment. (2003 Feb 14, J Biol Chem) PubMed / full text
   more detail about this publication

rhoptry
  • "OP2-HA was expressed in T.¬†gondii. When localized with anti-HA antibody, ROP2-HA precisely co-localized with the mature rhoptry compartment, as detected with anti-ROP2 polyclonal antibody."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry
  • Other genes localised in this publication: mu1 adaptin

Que, X., Ngo, H., Lawton, J., Gray, M., Liu, Q., Engel, J., Brinen, L., Ghosh, P., Joiner, K. A., Reed, S. L.
The cathepsin B of Toxoplasma gondii, toxopain-1, is critical for parasite invasion and rhoptry protein processing. (2002 Jul 12, J Biol Chem) PubMed / full text
   more detail about this publication

rhoptry during intracellular tachyzoite
  • "Similar colocalization of toxopain-1 and ROP2 to the rhoptries was also observed using the ROP2 polyclonal antibodies (data not shown). "
  • Microscopy type: Light, EM
  • Microscopy method: monoclonal antibody
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during intracellular tachyzoite
  • Other genes localised in this publication: cysteine proteinase, putative

Hakansson, S., Charron, A. J., Sibley, L. D.
Toxoplasma evacuoles: a two-step process of secretion and fusion forms the parasitophorous vacuole. (2001 Jun 15, EMBO J) PubMed / full text
   more detail about this publication

evacuole and parasitophorous vacuole during tachyzoite invasion
  • "ROP proteins were discharged both into the forming parasitophorous vacuole and into numerous small, satellite vesicles that often extended in clusters out away from the vacuole (Figure 1A)."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PV and evacuole during tachyzoite invasion
  • Other genes localised in this publication: rhoptry protein, putative, dense granule protein 1 / major antigenp24

Hoff, E. F., Cook, S. H., Sherman, G. D., Harper, J. M., Ferguson, D. J., Dubremetz, J. F., Carruthers, V. B.
Toxoplasma gondii: molecular cloning and characterization of a novel 18-kDa secretory antigen, TgMIC10. (2001 Feb, Exp Parasitol) PubMed / full text
   more detail about this publication

rhoptry
  • "(three antigenically cross-reacting rhoptry proteins)"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: RH, 2F
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry
  • Other genes localised in this publication: SRS29B (= SAG1, P30), microneme protein MIC4, microneme protein 10

Ding, M., Clayton, C., Soldati, D.
Toxoplasma gondii catalase: are there peroxisomes in toxoplasma? (2000 Jul, J Cell Sci) PubMed / full text
   more detail about this publication

rhoptry during intracellular tachyzoite
  • "Staining for the dense granules was obtained by using anti-GRA3 antibodies (Leriche and Dubremetz, 1991), an anti-MIC3 was used to detect the micronemes (Achbarou et al., 1991) and an anti-ROP2 for the rhoptries (Fig. 6)."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RHhxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during intracellular tachyzoite
  • Other genes localised in this publication: peroxisomal catalase, dense granule protein 3, microneme protein MIC3

Kaasch, A. J., Joiner, K. A.
Targeting and subcellular localization of Toxoplasma gondii catalase. Identification of peroxisomes in an apicomplexan parasite. (2000 Jan 14, J Biol Chem) PubMed / full text
   more detail about this publication

rhoptry during intracellular tachyzoite
  • "Catalase (green channel) does not colocalize with various parasite organelles by IFA. Micronemes (a), rhoptries (c), and dense granules (e) (all in the red channel) are labeled with monoclonal mouse antibodies to organellar proteins."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry during intracellular tachyzoite
  • Other genes localised in this publication: peroxisomal catalase, dense granule protein 3, microneme protein 2

Ferguson, D. J., Cesbron-Delauw, M. F., Dubremetz, J. F., Sibley, L. D., Joiner, K. A., Wright, S.
The expression and distribution of dense granule proteins in the enteric (Coccidian) forms of Toxoplasma gondii in the small intestine of the cat. (1999 Mar, Exp Parasitol) PubMed / full text
   more detail about this publication

rhoptry during merozoite

Beckers, C. J., Dubremetz, J. F., Mercereau-Puijalon, O., Joiner, K. A.
The Toxoplasma gondii rhoptry protein ROP 2 is inserted into the parasitophorous vacuole membrane, surrounding the intracellular parasite, and is exposed to the host cell cytoplasm. (1994 Nov, J Cell Biol) PubMed / full text
   more detail about this publication

parasitophorous vacuole membrane during tachyzoite invasion, rhoptry during tachyzoite
  • "Antisera prepared against whole parasites or a parasite fraction enriched in rhoptries and dense granules reacted with the PVM in these permeabilized cells, indicating that parasite-encoded antigens were exposed on the cytoplasmic side of the PVM."
  • Microscopy type: Light, EM
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PVM during tachyzoite invasion, rhoptries during tachyzoite
  • Other genes localised in this publication: -

Herion, P., Hernandez-Pando, R., Dubremetz, J. F., Saavedra, R.
Subcellular localization of the 54-kDa antigen of Toxoplasma gondii. (1993 Apr, J Parasitol) PubMed / full text
   more detail about this publication

rhoptry
  • "Immunofluorescence and immunoelectron-microscopy showed that the antibody reacted with an antigen localized in the rhoptries, 1 of the organelles of the apical complex of the zoites involved in host cell invasion."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: rhoptry
  • Comment: no fulltext available online
  • Comment: no strain information in abstract
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_29109

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • TGME49_075300 Rhoptry kinase family protein ROP2B (incomplete catalytic triad)
  • NCLIV_001950 Rhoptry protein ROP7 (EC 2.7.11.12), related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_015780 Rhoptry kinase family protein ROP2A (incomplete catalytic triad)
MENCASVRSSSCLIWLAAAFFVSALGHVQQGAGVVRPRHWQNSEAAVSVRPPGGASPRPFHSPIEPVAFIDGEHDEDKHE
GSWLEQEAAEDVTPLPDSHTEAQTQSPSAFRRLTRRLRFWRRGVTGGSDAGEEAPQTPRPSLRTRILQYLRRVGTFFRRD
IPAAALRFFRRFRRVRQPVFPPDEFPEDVDTNPIYFRGTDPGDVVIEELFNRIPQANVRTTSEYMQSAADSLVSTSLWNT
GQPFRVESELGERPRTLVRGTVLGQEDPYAYLEATDQETGESFEVHVPYFTERPPSNAIKQMKEEVLRLRLLRGIKNQKQ
AKVHLRFIFPFDLVKDPQKKKMIRVRLDERDMWVLSRFFLYPRMQSNLQTFGEVLLSHSSTHKSLVHHARLQLTLQVIRL
LASLHHYGLVHTYLRPVDIVLDQRGGVFLTGFEHLVRDGASAVSPIGRGFAPPETTAERMLPFGQHHPTLMTFAFDTWTL
GLAIYWIWCADLPNTDDAALGGSEWIFRSCKNIPQPVRALLEGFLRYPKEDRLLPLQAMETPEYEQLRTELSAALPLYQT
DGEPTREGGAPPSGTSQPDEAGAAEAVTAI

Gene-Specific Links for TGME49_015780

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins