ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_015770 (ROP8)

Rhoptry kinase family protein ROP8 (incomplete catalytic triad), a gene from Toxoplasma gondii

Compiled localisation
rhoptry during tachyzoite

Who localised this protein by microscopy?

Beckers, C. J., Wakefield, T., Joiner, K. A.
The expression of Toxoplasma proteins in Neospora caninum and the identification of a gene encoding a novel rhoptry protein. (1997 Nov, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

rhoptry during tachyzoite
  • "Immunofluorescence analysis with the monoclonal antibody T3 4A7 revealed an intense labeling of the apical, rhoptry-rich region of ROP8-transfected Neospora"
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody to ROP2
  • Strain: NC-1
  • Gene model mapping comments: blast from AF011377, annotation matches
  • Localisation record: rhoptry during tachyzoite
  • Comment: localised by transfection into Neospora caninum, not localised directly in T. gondii
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_29109

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • TGME49_075300 Rhoptry kinase family protein ROP2B (incomplete catalytic triad)
  • NCLIV_001950 Rhoptry protein ROP7 (EC 2.7.11.12), related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_015770 Rhoptry kinase family protein ROP8 (incomplete catalytic triad)
MFSVLRNRNMRHGPSIGSSSCLIWLAAAFFVSALGHVQQGAGVVRPRHWQNSEAAVSVRSPGGASPRPFHSPIEPVAFID
GEHDEDKHEGSWLEQEAAEDVTPLPDSHTEAQTQSPSAFRRLTRRLRFWRRGVTGGSDAGEEAPQTPRPSLRTRILQYLR
RVGTFFRRDIPAAALRFFRRFRRVRQPVFPPDEFPEDVDTNPIYFRGTDPGDVVIEELFNRIPQANVRTTSEYMQSAADS
LVSTSLWNTGQPFRVESELGERPRTLVRGTVLGQEDPYAYLEATDQETGESFEVHVPYFTERPPSNAIKQMKEEVLRLRL
LRGIKNQKQAKVHLRFIFPFDLVKDPQKKKMIRVRLDERDMWVLSRFFLYPRMQSNLQTFGEVLLSHSSTHKSLVHHARL
QLTLQVIRLLASLHHYGLVHTYLRPVDIVLDQRGGVFLTGFEHLVRDGARVVSSVSRGFEPPELEARRATISYHRDRRTL
MTFSFDAWALGLVIYWIWCADLPITKDAALGGSEWIFRSCKNIPQPVRALLEGFLRYPKEDRLLPLQAMETPEYEQLRTE
LSAALPLYQTDGEPTREGGAPPSGTSQPDEAGAAEAVTAI

Gene-Specific Links for TGME49_015770

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins