ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_015590 ()

succinate dehydrogenase (ubiquinone) flavoprotein subunit, mitochondrial, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10363

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF10_0334 flavoprotein subunit of succinate dehydrogenase
  • PBANKA_051820 flavoprotein subunit of succinate dehydrogenase, putative
  • PY05468 flavoprotein subunit of succinate dehydrogenase
  • PVX_111005 flavoprotein subunit of succinate dehydrogenase, putative
  • PCHAS_051830 flavoprotein subunit of succinate dehydrogenase, putative
  • PKH_061930 flavoprotein subunit of succinate dehydrogenase, putative
  • TGME49_015590 succinate dehydrogenase (ubiquinone) flavoprotein subunit, mitochondrial, putative
  • NCLIV_052500 hypothetical protein
  • NCLIV_068970 Succinate dehydrogenase flavoprotein subunit, related
  • CMU_043190 succinate dehydrogenase, flavoprotein subunit, putative
  • TA03455 succinate dehydrogenase (flavoprotein) subunit, putative
  • BBOV_IV007210 succinate dehydrogenase alpha subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_015590 succinate dehydrogenase (ubiquinone) flavoprotein subunit, mitochondrial, putative
MHASASLTQALRPYARRPLSSALSRSSLSPALAAGVARGLNAAQPQATGPSFVQQKRFFTNVKKPAYRVIDHEYDAIVVG
AGGAGLRAAFGLASAGIKTACLSKLFPTRSHTVAAQGGINAALGNMTEDDWRWHAYDTVKGSDWLGDQDAIQHMCREAPK
VVRELESYGLPFSRTEDGRIYQRAFGGQSLRFGKGGQAYRCAAAADRTGHAMLHSLYGQSLAHDCKFFVEYFALDLMMSG
ENDERKCHGVVAMCMEDGSIHRFAAKHTVLATGGYGRAYQSCTSAHTCTGDGGGMVSRAGLPLEDLEFVQFHPTGIFPAG
CLITEGCRGEGGILRNGQGEAFMARYAPTAKDLASRDVVSRSMTIEIREGRGCGPNRDHMHLDLTHLPPATLHERLPGIT
ETAKIFAGVNAEKEPIPVLPTVHYNMGGIPTNWRAQVLTTSRSKAGGPDKIVQGLYAAGEAACASVHGANRLGANSLLDL
VVFGREAARTIADECKKDASAPSLPPNAGEETLAMVDRLRHSNGPLTTAQIRQRMQKTMQDHAAVFRTGAVLREGVEMMK
DVAKSFADVGVKDRSLSWNTDLIETLELQNLLTQAVQTIVGAEARKESRGAHAREDFKERDDKNWMKHTLSWQTHREVEK
AEFPLTYRQVISQPLDNEMEHIPPAKRVY

Gene-Specific Links for TGME49_015590

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins