ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_015450 (AQP1)

aquaporin, a gene from Toxoplasma gondii

Compiled localisation
vacuole during extracellular tachyzoite

Who localised this protein by microscopy?

Miranda, K., Pace, D. A., Cintron, R., Rodrigues, J. C., Fang, J., Smith, A., Rohloff, P., Coelho, E., de Haas, F., de Souza, W., Coppens, I., Sibley, L. D., Moreno, S. N.
Characterization of a novel organelle in Toxoplasma gondii with similar composition and function to the plant vacuole. (2010 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

vacuole during extracellular tachyzoite
  • "A Large Vacuole in Extracellular Tachyzoites Labels with Antibodies Against a Vacuolar-H+-pyrophosphatase (TgVP1), a cathepsin L (TgCPL) and an aquaporin (TgAQP1)"
  • Microscopy type: light
  • Microscopy method: antibody against LGYVGTHAYHNPVPLRFLNFRGL, C terminal myc tag
  • Strain: RH
  • Gene model mapping comments: blast from AAP33053.1, annotation matches, taken directly from publication
  • Localisation record: vacuole during extracellular tachyzoite
  • Other genes localised in this publication: H+-translocating inorganic pyrophosphatase TVP, putative, cathepsin L-like thiolproteinase, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_29337

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_015450 aquaporin
MDQFVFSGGSEGGGELGGDRERDSLTPELGRFEHLIFNMQKYFCEFFAALVIVSAVAFGLAKEGGAQAAPLSITSTIFAL
ITLFKDISGAHFNPAVSCTIYMTDPRFTLVDLLCYVAAQLIGGTVGAFIGYGIMGKALDILPLDPGMSASRQLFHEVIPT
MVMIYAVLVLVFGYGVMWELTVPFVVGACVLAGAFAGATMNPAVTFGIFISNICTKNTNIDVAALLVTLFGPFLGAMFAF
LGYVGTHAYHNPVPLRFLNFRGL

Gene-Specific Links for TGME49_015450

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins