ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_015070 (Fd)

ferredoxin, a gene from Toxoplasma gondii

Compiled localisation
apicoplast during intracellular tachyzoite

Who localised this protein by microscopy?

Seeber, F., Aliverti, A., Zanetti, G.
The plant-type ferredoxin-NADP+ reductase/ferredoxin redox system as a possible drug target against apicomplexan human parasites. (2005, Curr Pharm Des) PubMed / full text
   more detail about this publication

apicoplast during intracellular tachyzoite
  • "Immunolocalization of T. gondii ptFd in the apicoplast of intracellular parasites using a polyclonal antibody raised against recombinant T. gondii ptFd (I). For comparison the co-localization of T. gondii ptFNR, transgenically expressed as an HA-tagged protein [80], is also shown (II)."
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain:
  • Gene model mapping comments: Blast from AJ489783, annotation matches
  • Localisation record: apicoplast during intracellular tachyzoite
  • Comment: strain information not found
  • Other genes localised in this publication: ferredoxin NADP+ oxidoreductase, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_14702

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_015070 ferredoxin
MADASLLPGEPAVAGAMSREALFPRRMPVFPSGAFLSPPRFSRILLVVCLLFFSSSPLAFVSSLSAWNSASSAASALSGA
SSPSSSCSFAASPSRECRRASSLPLGASTNARPGRLREPERSAKFRFPSVSAFLGPSASRPSSTVSASSAEATLPTLGRQ
PGASASSLVSSAPLPRPCLGAAQRTTGLWSHRAARLCSEGATLEAGWGKAEPRNVRLRIHSRLFHRIKLQTPDGETKELE
CAEDEYILDAAEAAGIELPYSCRGGSCSTCAGKLLMGSVDGSEQVYLDDAQQKKGYVLLCTAYPKEDCTILTHQEDQLHS
EGGDE

Gene-Specific Links for TGME49_015070

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins