ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_014940 (M2AP, proTgM2AP)

MIC2-associated protein M2AP, a gene from Toxoplasma gondii

Compiled localisation
microneme during 16 hours after tachyzoite infection and extracellular tachyzoite and intracellular tachyzoite
moving junction and parasite plasma membrane during tachyzoite invasion
anterior vesicle and dense granule and early endosome and trans-golgi network during extracellular tachyzoite and intracellular tachyzoite
endosome-related compartment
vesicle during intracellular tachyzoite
late endosome during 24 hours after tachyzoite infection

Who localised this protein by microscopy?

Parussini, F., Coppens, I., Shah, P. P., Diamond, S. L., Carruthers, V. B.
Cathepsin L occupies a vacuolar compartment and is a protein maturase within the endo/exocytic system of Toxoplasma gondii. (2010 Jun, Mol Microbiol) PubMed / full text
   more detail about this publication

late endosome during 24 hours after tachyzoite infection

Sugi, T., Kato, K., Kobayashi, K., Pandey, K., Takemae, H., Kurokawa, H., Tohya, Y., Akashi, H.
Molecular analyses of Toxoplasma gondii calmodulin-like domain protein kinase isoform 3. (2009 Dec, Parasitol Int) PubMed / full text
   more detail about this publication

microneme during 16 hours after tachyzoite infection
  • "The apical expression of TgCDPKif3 was not co-localized with that of a microneme marker, M2AP [26], suggesting that the apical location of TgCDPKif3 was not in microneme."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during 16h post infection intracellular tachyzoite
  • Other genes localised in this publication: CAM kinase, CDPK family TgCDPK1_2 (TGTPK4)

Agop-Nersesian, C., Naissant, B., Ben Rached, F., Rauch, M., Kretzschmar, A., Thiberge, S., Menard, R., Ferguson, D. J., Meissner, M., Langsley, G.
Rab11A-controlled assembly of the inner membrane complex is required for completion of apicomplexan cytokinesis. (2009 Jan, PLoS Pathog) PubMed / full text
   more detail about this publication

vesicle during intracellular tachyzoite

Breinich, M. S., Ferguson, D. J., Foth, B. J., van Dooren, G. G., Lebrun, M., Quon, D. V., Striepen, B., Bradley, P. J., Frischknecht, F., Carruthers, V. B., Meissner, M.
A dynamin is required for the biogenesis of secretory organelles in Toxoplasma gondii. (2009 Feb 24, Curr Biol) PubMed / full text
   more detail about this publication

endosome-related compartment
  • "We were not able to colocalize DrpB with markers of the secretory pathway, such as the cis-medial Golgi marker GRASP-RFP [20], the trans-Golgi marker UDP-N-acetyl-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase T1 fused to yellow fluorescent protein (YFP) (TgGalNac-YFP; M. Nishi and D.S. Roos, personal communication) [4], the propeptide of M2AP (a precursor microneme protein that localizes in endosome-related compartments) [4], VP-1 (a vacuolar proton pyrophosphatase) [4], or the μ1 chain of the adaptin-1 complex 3."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH hxgprt−
  • Gene model mapping comments: inferred from another publication
  • Localisation record: Endosome-related compartments
  • Other genes localised in this publication: dynamin-like protein, putative, mu1 adaptin, H+-translocating inorganic pyrophosphatase TVP, putative, microneme protein 8

Harper, J. M., Huynh, M. H., Coppens, I., Parussini, F., Moreno, S., Carruthers, V. B.
A cleavable propeptide influences Toxoplasma infection by facilitating the trafficking and secretion of the TgMIC2-M2AP invasion complex. (2006 Oct, Mol Biol Cell) PubMed / full text
   more detail about this publication

anterior vesicle and dense granule and early endosome and microneme and trans-golgi network during extracellular tachyzoite and intracellular tachyzoite

Harper, J. M., Zhou, X. W., Pszenny, V., Kafsack, B. F., Carruthers, V. B.
The novel coccidian micronemal protein MIC11 undergoes proteolytic maturation by sequential cleavage to remove an internal propeptide. (2004 Aug, Int J Parasitol) PubMed / full text
   more detail about this publication

microneme during extracellular tachyzoite
  • ""
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during extracellular tachyzoite
  • Other genes localised in this publication: microneme TgMIC5 protein, microneme protein MIC11

Brossier, F., Jewett, T. J., Lovett, J. L., Sibley, L. D.
C-terminal processing of the toxoplasma protein MIC2 is essential for invasion into host cells. (2003 Feb 21, J Biol Chem) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite invasion
  • "Proteins bound to the beads were resolved on 10% SDS-PAGE gels and Western blotted using anti-c-Myc antibodies. B, immunolocalization of endogenous M2AP and epitope-tagged MIC2 at the surface of parasites following secretion."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: surface during tachyzoite invasion
  • Other genes localised in this publication: microneme protein 2, SRS29B (= SAG1, P30)

Rabenau, K. E., Sohrabi, A., Tripathy, A., Reitter, C., Ajioka, J. W., Tomley, F. M., Carruthers, V. B.
TgM2AP participates in Toxoplasma gondii invasion of host cells and is tightly associated with the adhesive protein TgMIC2. (2001 Aug, Mol Microbiol) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite, moving junction during tachyzoite invasion
  • "TgM2AP co-localizes with TgMIC2 in the micronemes of intracellular tachyzoites.... The upper row shows that TgM2AP (green) was mobilized from the micronemes to the parasite apical surface during attachment to a target cell. A small nascent parasitophorous vacuole was visible by staining with ROP1"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: 2F
  • Gene model mapping comments: Blast from AF364813.1, annotation matches
  • Localisation record: microneme during intracellular tachyzoite, moving junction during tachyzoite invasion
  • Other genes localised in this publication: rhoptry protein, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115745

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_014940 MIC2-associated protein M2AP
MKLAAVSSAAFAAAFFPAVVNARKVGNPAAQPSVLVNEPVALAQLSTFLELVEVPCNSVHVQGVMTPNQMVKVTGAGWDN
GVLEFYVTRPTKTGGDTSRSHLASIMCYSKDIDGVPSDKAGKCFLKNFSGEDSSEIDEKEVSLPIKSHNDAFMFVCSSND
GSALQCDVFALDNTNSSDGWKVNTVDLGVSVSPDLAFGLTADGVKVKKLYASSGLTAINDDPSLGCKAPPHSPPAGEEPS
LPSPENSGSATPAEESPSESESVPSLPLSQIPSEVPLSQESPVPPQDGENPDSPQNEDNSMQEVENSASQSDIEAQRQAE
NGRLPSDDEA

Gene-Specific Links for TGME49_014940

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins