ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_014850 (Dxr)

1-deoxy-D-xylulose 5-phosphate reductoisomerase, putative, a gene from Toxoplasma gondii

Compiled localisation
apicoplast during intracellular tachyzoite

Who localised this protein by microscopy?

Baumeister, S., Wiesner, J., Reichenberg, A., Hintz, M., Bietz, S., Harb, O. S., Roos, D. S., Kordes, M., Friesen, J., Matuschewski, K., Lingelbach, K., Jomaa, H., Seeber, F.
Fosmidomycin uptake into Plasmodium and Babesia-infected erythrocytes is facilitated by parasite-induced new permeability pathways. (2011, PLoS One) PubMed / full text
   more detail about this publication

apicoplast during intracellular tachyzoite
  • "DOXP reductoisomerase localizes to the apicoplast in T. gondii tachyzoites and P. falciparum blood stages"
  • Microscopy type: fixed light
  • Microscopy method: antibody to P. falciparum homologue
  • Strain: RHβ1
  • Gene model mapping comments: P. falciparum orthologue gene ID PF14_0641 suggested by Stuart Ralph, supplementary multiple sequence alignment http://www.plosone.org/article/fetchSingleRepresentation.action?uri=info:doi/10.1371/journal.pone.0019334.s002 agrees
  • Localisation record: apicoplast during intracellular tachyzoite
  • Other genes localised in this publication: 1-deoxy-D-xylulose 5-phosphate reductoisomerase

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13658

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_133060 1-deoxy-D-xylulose 5-phosphate reductoisomerase, putative
  • PY05578 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  • PVX_117100 1-deoxy-D-xylulose 5-phosphate reductoisomerase, putative
  • PCHAS_133520 1-deoxy-D-xylulose 5-phosphate reductoisomerase, putative
  • PKH_123820 1-deoxy-D-xylulose 5-phosphate reductoisomerase, putative
  • NCLIV_051900 1-deoxy-D-xylulose 5-phosphate reductoisomerase, putative
  • TP02_0073 1-deoxy-D-xylulose 5-phosphate reductoisomerase, putative
  • TA14290 1-deoxy-D-xylulose 5-phosphate reducto-isomerase, putative
  • BBOV_III010740 1-deoxy-D-xylulose 5-phosphate reductoisomerase family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_014850 1-deoxy-D-xylulose 5-phosphate reductoisomerase, putative
MLKSPVFIFSDISSAAVSPVSALDRRLLLDANSCRELLRRTEEDPVSSLVSSPASLAPPASPPSTRVKRLVVLGSTGSIG
KSTLEIAREFPDIFQIVGLAAGGSNLALLAEQVAAFRPQYVYLGDSSKVAELQERLNDHERSAAFPRPRLLLGDEGLAEL
ACVPNYDILVSAIVGFKGVLPTLKALEAGKDVALANKEALVAAGPVFRCLLSTRGLLYGDQERQDRHERSHRSGDQEGDR
EEDTDGDRREECDKRRAKAGQKCGLLLPVDSEHSAIFQALQGVPASCYPPRKLLLTASGGPFRGRTRDELEQVTLESALK
HPKWSMGAKITIDSATLMNKGLEVIEAHFAFGCPYSSIEVLVHPQAVIHSAVELRDGATLAQLGLPDMKLPIAYALTWPH
RLAAPWSAGVDLTREGNLTFEKPDLNTFGCLGLAYEAGERGGVAPACLNAANEVAVERFRNKEIGFVDIEDTVRHVMALQ
ERERDNFSDVSLQDVFDADHWARTAARAFKPRK

Gene-Specific Links for TGME49_014850

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins