ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_014320 (GT1)

facilitative glucose transporter, putative, a gene from Toxoplasma gondii

Compiled localisation
parasite plasma membrane during intracellular tachyzoite and tachyzoite

Who localised this protein by microscopy?

Blume, M., Rodriguez-Contreras, D., Landfear, S., Fleige, T., Soldati-Favre, D., Lucius, R., Gupta, N.
Host-derived glucose and its transporter in the obligate intracellular pathogen Toxoplasma gondii are dispensable by glutaminolysis. (2009 Aug 4, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

parasite plasma membrane during intracellular tachyzoite

Pomel, S., Luk, F. C., Beckers, C. J.
Host cell egress and invasion induce marked relocations of glycolytic enzymes in Toxoplasma gondii tachyzoites. (2008 Oct, PLoS Pathog) PubMed / full text
   more detail about this publication

parasite plasma membrane during tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10797

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_014320 facilitative glucose transporter, putative
MATEEMREKSLKREAESLWDIPPESYASKACSCMGTAAQLVMVAVLGSFQFGFNLSALNTSKAFIILDFGWCKDENGGHY
SDCDTGLVYGSLINTAVFLGACVGCLLGGRLTDFGRRASLIFTHCVCTLGCILSAAAEGFPTLLIARLVVGVAVGMFTVC
VPMYLSEVTPDDRRGYFGTFHQLFITLGIFFGTLLGLAFGNAPAGDEVYEVSTFQQAWWRVMLGLPAVVSLLAIWLLWFV
FPFETPQYMVEKKQRAKATALLREIYGRDNVDVEIQRIVTSRYQQKIQRAQQLTVWKAIVHPTYRSVILLACLLSIMQQF
TGINVLVANSNNLYSSLKLPQDAVTGLTVGFTALNVFLTVITIPLVDRLGRRTLLLFSEAVMFVAMGIAFVANLVDQSNT
AVQWVTVACVYVFIVGFAVGYGPVLWIYIHEIFPPEIKQGAASLASALNWVATVAIVLPSDFLLKQGFSVFVGICTVALA
IIFVVTFIFVKETKGLSIEESPYFKGKSRALGSPSAFRMELNSSPSVPLTRGEGAAASAEKGMGLTDAAAMNGGRGVSDD
LTKGTEVV

Gene-Specific Links for TGME49_014320

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins