ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_014290 ()

intracellular protease, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10987

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFF1335c 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme
  • PBANKA_112620 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative
  • PY04638 Drosophila melanogaster CG1349 gene product
  • PVX_114480 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative
  • PCHAS_112570 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative
  • PKH_112180 4-methyl-5(b-hydroxyethyl)-thiazol monophosphate synthase, putative
  • TGME49_014290 intracellular protease, putative
  • NCLIV_051530 hypothetical protein
  • cgd5_1650 hypothetical protein
  • Chro.50218 CG1349 gene product
  • CMU_040190 DJ-1 family protein
  • TA04310 4-methyl-5(b-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative
  • BBOV_I002290 4-methyl-5(B-hydroxyethyl)-thiazol monophosphate biosynthesis enzyme, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_014290 intracellular protease, putative
MSPLGFGAFLSPLLLFCVSPHLRTGVSRSFSSFLKPQKLQRFVSREYPRRRCLPSLHFTSRCFSTRLSSRKMAVKVLVPV
AHDSEEIEAVSIIDTLRRAGAEVVVASVEDTEIVRMSRGVCVKADKLISAVENETYDCIAIPGGMPGAERCRDSAALTAM
LKTHKAQGKLIAAICASPAVVLQTHGLLQGEKAVAYPCFMDQFPADMRGEGRVCVSNKIVTSVGPSSAIEFALKLIEVLY
NKEQAKKIAAQLLYAY

Gene-Specific Links for TGME49_014290

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins