ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_014270 ()

translation initiation factor IF-2, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10834

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFF0345w translation initiation factor IF-2, putative
  • PBANKA_010560 translation initiation factor IF-2, putative
  • PY05837 translation initiation factor if-2
  • PVX_113515 translation initiation factor IF-2, putative
  • PCHAS_010620 translation initiation factor IF-2, putative
  • PKH_114230 translation initiation factor IF-2, putative
  • TGME49_014270 translation initiation factor IF-2, putative
  • NCLIV_051510 GM14051, related
  • cgd6_2180 Fun12p GTpase; translation initiation factor IF2
  • Chro.60256 translation initiation factor if-2, 73082-68138
  • CMU_007690 eukaryotic tranlation initiation factor 5B, putative
  • TP02_0181 translation initiation factor IF-2, putative
  • TA11735 translation initiation factor if-2, putative
  • BBOV_II007250 translation initiation factor IF-2, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_014270 translation initiation factor IF-2, putative
MAPKKKGGRGGRRGGLSSDEEFEAKKPTPVPAADSTDSESSSEDSSEDERPRRGASRFALAVSSSESDSDSESESASGSE
SESESGGGSESGSEREDKSKARDGKAAPKQAGRKVESSSSADEKEAESSDEESKNAKGGGKRKSERESDNSDEELKTKAQ
PSRPQGKAKASPKKAQGKGKKGKQVDDDDLDAVLEEVGASVPGKAESPAVAEKGKKGKKDKKEADDLDDLLAELESPAKK
GASPVAAAAAAPVTVEKPAVSDEEAEGRGAAPGGLTKNQLKKQKKKQAAQKKVAQKKDDSDDETKPAPPAKKGPLSAAAR
AAQERLRLLKEEEERQKKEEEERKRQEEEQRKREEEEEKRRQEERALREQRRAERKQRLKEEGKLLSSKEKKERERQQAF
LRQLQEKGVVLGEDQSETSHKKKSSRAVDGKKKKKKEKTETPEDAEEAESSRRREEEPREEEKKRKEEEPAHENWEELLD
ELDDDGDSPDAKTNTEKEQQSQKVKKGGANARQRAAMEAAAAVEAAAAAEKKAQEEAAEKKKKEVELRSPIVCILGHVDT
GKTKLLDKIRHTNVQDNEAGGITQQIGATYFPPEALVEQCRKFSKAELRLPGLLIIDTPGHSSFTNLRARGSSLCDLAIV
VVDIMHGMEQQTRESLELLKQKKCPFIIALNKIDRLYGWNSIPWQHDIPKHLASQGPSTRDEFDRRAMEAITQLQEEGFN
CRLYWENEDVRKNVSVVPTSAVTGEGVPDLLNLVVQVNQTLMQRTIAKEAVDSRLARGDRQLQCTILEVKAIDGLGTTID
VILVHGTLYEGDKIVVCGMSGPIVTTIRALLTPQPLKELRVKGEYIQHAFIQAAMGVKISAPNLEEAVAGTSVFVVEEDD
DIEDLKEEVMSDMGSIFKSVDRTGSGVYVMASTLGSLEALLVFLQESKIPVFGVNIGTVQKKDVKKASIMREKGRPDLSV
ILAFNVKVDPEAEKEAKTLGVKIMTAEIIYHLFDEFTAYFQSMKEEKKKAVAQEAIFPCILGVLPQYIFNKKDPLILGVV
VEEGILKVGTPLCVPDKGDLRIGRVVSLEVNKKPCDKATKGQEVCVKIAGEPTVMIGRHFDAKNKLVSRLTRDSIDCLKE
HFRDEMSKDDWKTVIHLKKILGIQ

Gene-Specific Links for TGME49_014270

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins