ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_014210 ()

centromere/microtubule binding protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10157

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF10_0175 tRNA pseudouridine synthase, putative
  • PF14_0174 pseudouridine synthase, putative
  • PF14_0175 conserved Plasmodium protein, unknown function
  • PBANKA_050230 tRNA pseudouridine synthase, putative
  • PBANKA_102510 conserved Plasmodium protein, unknown function
  • PBANKA_102520 pseudouridine synthase, putative
  • PY02575 tRNA-pseudouridine synthase B-related
  • PY02644 TruB family pseudouridylate synthase, putative
  • PY05447 unknown protein-related
  • PVX_001765 tRNA pseudouridine synthase, putative
  • PVX_085570 hypothetical protein, conserved
  • PVX_085575 tRNA pseudouridine synthase, putative
  • PCHAS_050240 tRNA pseudouridine synthase, putative
  • PCHAS_102590 conserved Plasmodium protein, unknown function
  • PCHAS_102600 pseudouridine synthase, putative
  • PKH_060210 tRNA pseudouridine synthase, putative
  • PKH_133020 conserved Plasmodium protein, unknown function, fragment
  • PKH_133030 tRNA pseudouridine synthase, putative
  • TGME49_014210 centromere/microtubule binding protein, putative
  • TGME49_106520 tRNA pseudouridine synthase B, putative
  • NCLIV_044710 tRNA pseudouridine synthase B, putative
  • NCLIV_051450 centromere/microtubule binding protein, putative
  • cgd3_3850 Cbf5p; centromere-binding factor 5 like PUA domain containing protein with a type I pseudouridine synthase domain
  • Chro.30435 hypothetical protein
  • CMU_032000 H/ACA ribonucleoprotein complex subunit 4, putative
  • TP02_0380 tRNA pseudouridine synthase, putative
  • TP02_0508 rRNA pseudouridine synthase, putative
  • TA12870 RNA modification (pseudouridylation) protein TruB family member, putative
  • TA13560 centromere/microtubule binding protein, putative
  • BBOV_II005520 rRNA pseudouridine synthase, putative family protein
  • BBOV_III005720 tRNA pseudouridine synthase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_014210 centromere/microtubule binding protein, putative
MKEATSDPGLVASAGTEGGKKKKKTDNYAIEPNSSSPPIDTSKWPLLLKHYDRLNVRTGHYTPLPHGCSPLCRPLQQYIN
YGAMNLDKPANPSSHEVVAWLKKILRVEKTGHSGTLDPKVTGCLLVCINRATRLVKSQQSAGKEYVCIIRFHAKPESKAK
VARALETLTGALFQRPPVVAAVKRQLRIRTIYASRLLDYDEQRHMAVFWAKCEAGTYIRTLCVHLGLVLGCGAHMQELRR
VRSGNLGERDHLVTMHDVLDAMHVYDSTRDETYLRRTIFPLELLLTGFPRIVVKDSCVNAICYGAKLMIPGVLRFESGIE
VHQEVVLMTTKGEAIALGVAQMTSSVIATVDHGVVSTVKRVLMDRDTYDMRWGYGPRASEKKKMILAGLLDKKGKPNEKT
PASWLKSEGYLPKLCGSEETENGEATEAAVKEEEQPRVKEEPVDEDEEERRRRKKEKKLKKKAREAEEEESERKRRLSQG
SENGDAEEEVREKKKKKKSSSAEEE

Gene-Specific Links for TGME49_014210

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins