ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_014080 (Toxofilin)

toxofilin, a gene from Toxoplasma gondii

Compiled localisation
rhoptry during tachyzoite invasion and tachyzoite
host cell during tachyzoite invasion
parasite plasma membrane during 24 hours after tachyzoite infection
cytoplasm and posterior during tachyzoite gliding motility and tachyzoite invasion
apical and nowhere except apical during intracellular tachyzoite

Who localised this protein by microscopy?

Lodoen, M. B., Gerke, C., Boothroyd, J. C.
A highly sensitive FRET-based approach reveals secretion of the actin-binding protein toxofilin during Toxoplasma gondii infection. (2010 Jan, Cell Microbiol) PubMed / full text
   more detail about this publication

host cell and rhoptry during tachyzoite invasion, parasite plasma membrane during 24 hours after tachyzoite infection
  • "This assay revealed that the actin-binding protein toxofilin appears to be secreted into host cells during invasion. Examination of the resulting transgenic parasite clones by IFA demonstrated that both toxofilin–HA and toxofilin–HA–BLA localized predominantly to the rhoptries. Importantly, we did observe a low level of anti-HA staining detectable in the cytosol of some transgenic parasites, which is consistent with a previously reported localization of toxofilin (Poupel et al., 2000). "
  • Microscopy type: Light
  • Microscopy method: C terminal HA tag, polyclonal antibody to whole protein
  • Strain: RH HPT-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: host cell and rhoptry during tachyzoite invasion, membrane during tachyzoite 24h after invasion
  • Other genes localised in this publication: -

Bradley, P. J., Ward, C., Cheng, S. J., Alexander, D. L., Coller, S., Coombs, G. H., Dunn, J. D., Ferguson, D. J., Sanderson, S. J., Wastling, J. M., Boothroyd, J. C.
Proteomic analysis of rhoptry organelles reveals many novel constituents for host-parasite interactions in Toxoplasma gondii. (2005 Oct 7, J Biol Chem) PubMed / full text
   more detail about this publication

rhoptry during tachyzoite

Poupel, O., Boleti, H., Axisa, S., Couture-Tosi, E., Tardieux, I.
Toxofilin, a novel actin-binding protein from Toxoplasma gondii, sequesters actin monomers and caps actin filaments. (2000 Jan, Mol Biol Cell) PubMed / full text
   more detail about this publication

cytoplasm and posterior during tachyzoite gliding motility and tachyzoite invasion, apical and nowhere except apical during intracellular tachyzoite
  • "Finally, in motile parasites, during gliding or host cell entry, Toxofilin was localized in the entire cytoplasm, including the rear end of the parasite, whereas in intracellular tachyzoites, especially before they exit from the parasitophorous vacuole of their host cell, Toxofilin was found to be restricted to the apical end. "
  • Microscopy type: Light
  • Microscopy method: N terminal GFP tag
  • Strain: RH
  • Gene model mapping comments: Blast from AJ132777, annotation matches
  • Localisation record: entire cytoplasm and rear end of parasite during tachyzoite gliding and tachyzoite host cell entry, apical and nowhere except apical during intracellular tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_115725

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_014080 toxofilin
MAQYKSRPLAAVLLLITVGSLLTASESVQLSEGMKRLSMRGRSPSPKTGRFESGDEGTSTMSPSVAARQQELGLLRPEER
LIAGQAKAAALQTVHQLGAVVLTPEQAKAALLDEILRATQNLDLKKYENLNTEQQKAYEQVQKDLSLLSPETKALLIENH
RKEKSLLEQAKRLFRKRHYHVTRQAALAGQILNEQRDASGALQSGAVKAAIRKANEQYNVAEEDKNFNEEQHAAQLKKVG
AMP

Gene-Specific Links for TGME49_014080

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins