ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_013900 (RCC1)

regulator of chromosome condensation, putative, a gene from Toxoplasma gondii

Compiled localisation
nucleus during tachyzoite

Who localised this protein by microscopy?

Frankel, M. B., Mordue, D. G., Knoll, L. J.
Discovery of parasite virulence genes reveals a unique regulator of chromosome condensation 1 ortholog critical for efficient nuclear trafficking. (2007 Jun 12, Proc Natl Acad Sci U S A) PubMed / full text
   more detail about this publication

nucleus during tachyzoite
  • "TgRCC1 is reduced in the 73F9 mutant and nuclear-localized. "
  • Microscopy type: Light
  • Microscopy method: HA tag, N terminal FLAG tag
  • Strain: C1H
  • Gene model mapping comments: taken directly from publication
  • Localisation record: nucleus during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12743

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • MAL7P1.38 regulator of chromosome condensation, putative
  • PBANKA_122210 regulator of chromosome condensation protein, putative
  • PY01893 Regulator of chromosome condensation, putative
  • PVX_088110 hypothetical protein, conserved
  • PCHAS_122280 regulator of chromosome condensation protein, putative
  • PKH_010970 regulator of chromosome condensation, putative
  • NCLIV_013660 regulator of chromosome condensation, putative
  • cgd4_1350 regulator of chromosome condensation
  • Chro.40154 regulator of chromosome condensation
  • CMU_028450 regulator of chromosome condensation family protein
  • TA17690 regulator of chromosome condensation protein, putative
  • BBOV_III001630 regulator of chromosome condensation (RCC1) domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_013900 regulator of chromosome condensation, putative
MDANASVERLALSGPAETGGEGHACPLAQGIAPEAPSVYTPASGDSSRGAPQLAEEEDPLKPRGNEEEGEKKELNEKEKE
KESGEKEEKTTTGSPPEVEWRCPICLVVNAPTDLTCPCCEGPKPGTLPTSSPASSRPSNSASPFAPTAGSGFHLVSAVSS
SSPLSSASLSSSAGFFFGGTSGRKSEGFRPDLATPAPAALQVSVFQAFSSVRSSASAPSTVPAEALERGRGNGESGEGAQ
EAERQKRPAGFVPVFAASAQTGESEHELKKAAEKEEKETEKTCREEKAAEETKQREEEKAAEETKQREEEKEAEEAKQRE
EEKEEKKRLEVKLERPARDETRIPTAMIFMFGSGEMDQMPFWRSAEEDEDREVLEPRKVKEFEEKDVIRATSGAMHSAVL
TADGRCWTFGCGDGGALGRGDDLGDAALSPATVSIDDVTAVACGDSHTAFLTREGELYLAGTYRDAYGALGFPDFDAGAG
VAPTFISHRALPALVFSGLNRPSISQVACGENHTAALEVGGASFYVWGSNEFGQLGVSSSSSTASAAQARDEALVSPQGG
ECALADKLGFLLPQRRTVGELAPSVRNLSIRRIFCGRCTTFLSLSSSFASPALSSSATARFGERDASNGEATQNVEQALV
GCGRNRQGEVGCGAAAGAVVDKFEEIRSLRNVDLNFVGGGQFFSVALRTDGCLYTWGQSDFTGHGCSESYGVVEEPRVLE
KLAGQVHWVQCGSDHCLAATDAGRLYTWGAGQNFQLGNGEDVDIRRTPFLVDPQLFDSKFVLQAHGGSQHSMVLCWSGRY
APKDAEAKTDLAKAALRKRQRPDTDEEEDEAERESKRRRPSALETGAEATTGASHAEVGLGDEDGERAEQQEGAKEDEEK
EAGKAGKVEEKHDAVQGGAKRPRSAGSPAHRAASHAPGTKKDEKESGKAVSEEAAGAPSGCDSDVEDVTVDLQGSEEAAK
KRKPSSRGRGRVPRRHSAAPVEKKETASGRVSRAKAAQGREKKSGASEKIEKEAQKRGSSGTAKRAESKQTSKRPSSAAS
QQEKPQTVPRGKRETSRPPSRVGEKKQRETEKPAARKGERKAVKKTESKAEKKAEKATGKKGATKNARGGAPKKSASAGV
TVKKTIQKKTGRKATTPTSKRAAGKAAAKRRPNSR

Gene-Specific Links for TGME49_013900

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins