ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_013870 ()

ubiquitin carboxyl-terminal hydrolase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11002

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFD0680c ubiquitin carboxyl-terminal hydrolase a, putative
  • PBANKA_071590 ubiquitin carboxyl-terminal hydrolase a, putative
  • PY00546 ubiquitin specific protease 5
  • PVX_089655 ubiquitin carboxyl-terminal hydrolase a, putative
  • PCHAS_072500 ubiquitin carboxyl-terminal hydrolase a, putative
  • PKH_051760 ubiquitin carboxyl-terminal hydrolase a, putative
  • TGME49_013870 ubiquitin carboxyl-terminal hydrolase, putative
  • NCLIV_013610 Ubiquitin carboxyl-terminal hydrolase (EC 3.1.2.15), related
  • NCLIV_013620 Ubiquitin carboxyl-terminal hydrolase (EC 3.1.2.15), related
  • cgd6_4550 UBP_znfinger+UBA; UBP5 like deubiquitinating enzyme with a UB hydrolase domain and two UBA domains at the C-terminus
  • Chro.60521 ubiquitin-specific protease
  • CMU_020980 ubiquitin carboxyl-terminal hydrolase family protein
  • TP01_0316 ubiquitin carboxyl-terminal hydrolase a, putative
  • TA21275 ubiquitin carboxyl-terminal hydrolase (UBP14 homologue), putative
  • BBOV_IV004350 ubiquitin carboxyl-terminal hydrolase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_013870 ubiquitin carboxyl-terminal hydrolase, putative
MANPRPQGEATLPFSPYFGAFAETTPQDATEDLLVELRTLLGHARVATCMDTVVKTQCTYSLDSPLSPCGLFVNLSTFLA
ASIDALPLDCLLAKETSGPAPARAPDAKQICPRQRLYLHVYSKVDDEQAAKIHRQLHEAKGRGTPSDEKSQSLPPEDGTD
ISAEVGGEVQPHKLAINVEGGFQIEENSGDACPEALSNTFVYSLALLPPLLTLPRTSYRSTYLSSAVDCQDSAKMQEAWE
RSVLKQVKFVKINDALPEVLRAACQALIEHRGLGGAAASTGIGAWEEELKPSRYAENLEQVPNPPLVGPTDWRCADCGAT
ANLWLNLSDGYIGCGRKLYGVGGGCADGREGAAIRHFEETGSKYPLIVKLGTITPYSADVYCYAPDEDCSVLDPKLPDHL
AHFGINVQQLTKTEKSTNELALDWNVRHEWSRAMEADRELLPLNGAGCVGLRNLGNTCYVNAVLQVVTSLPLIREKYVSL
LPALLASSSPSAVHSSDFLLRQSSLAAALQSPRYRLQHARRRLAILKKVAGAAPNAETVQTLEKKLAESKAGAGLAYLET
DSVTPQLYRQMVGTLHAEFASSHQQDAEEFFSFLLQWLEERDREAETRVKQAREKLVSAQQGEATAQAIIAASEFSEREG
ACAEEALRKAKIEKLFTFAVEQRIECAETKQVRYSYTRQQVLSLPVPLDPAVQQRYEREQREREEVDRRSKKRQKKDAPE
DDKDLEDRSSPDSTTTVSSENGEHPRNETQTRENLVGTSPGGEEASCLPPPEELPSFTFSECLESFLSSTLLKDFYSSAT
GKKGEASKQLRLASFPPYLIVQLKRFFADQHWQAKKLYCPVLVPEELSIAESRGSGLREGEVVMPEETSASLHPSSAAAV
TAFDEELLATLQSMGFSENACKRACLAVQSSSPDACVDWLMSHMDDAEVNNPLPSDSPSSCVNEEAVAMISSMGFTAEQA
RAGLLAVGAGGDVCSRAADWLLNHMEDLDAAVNAVLANAEKPREEEMEDVSTLSPLERVTRDLDDEPTGLYKLHGFITHM
GVNANSGHYVCHVKRDGKLVLFNDEKVAEAVEPPIDLGYIYVFRRADVPE

Gene-Specific Links for TGME49_013870

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins