ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_010790 ()

dihydroorotate dehydrogenase, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10686

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_010210 dihydroorotate dehydrogenase, putative
  • PY02580 dihydroorotate dehydrogenase, putative
  • PVX_113330 dihydroorotate dehydrogenase, mitochondrial precursor, putative
  • PCHAS_010280 dihydroorotate dehydrogenase, putative
  • PKH_114660 dihydroorotate dehydrogenase, putative
  • TGME49_010790 dihydroorotate dehydrogenase
  • NCLIV_012040 dihydroorotate dehydrogenase, putative
  • TP02_0171 dihydroorotate dehydrogenase, putative
  • TA11695 dihydroorotate dehydrogenase, mitochondrial precursor, putative
  • BBOV_II007190 dihydroorotate dehydrogenase
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_010790 dihydroorotate dehydrogenase
MAPLTMHFQGRFALLRLPISSGKPLCRETRVRRSGTRPVSADNLSHARCVLPKCHSFCPAGGMQESPEARVTLSRGTSRN
FGTFLTALGNDVHWKSAFPGALLRTQIRKLSVSLHPRPGSAESSRPSAGLPPKDVDPEEIERIVRERTTRERKANRRLVF
LVLLLGTGVYCYSALQDVSSMIYSFYEPVTSVLFRYFSSGPLDPETAHGYTMELAKRGWLPVDYDREESALNVDINGLKF
LSPIGLAAGFDKHAEAPAALLRMGFSFLEVGSITPKPQPGNPKPRLFRLYEDRSVINRFGFNSNGADYAQTQLEAFSEAR
LRDPFTAQGVLGVSLGKNKTSEDAVADLREGVKKLGRFADFLVVNLSSPNTPGLRSLQSASHLAAIIDGVQEELDALDRQ
AQAASQKQRNERRRHGGNPEETKAFYANQTGRRPLFFVKIAPDLSMEEKESIAKVALEKNLDGFVVSNTTIQRPETLKSP
AKSETGGLSGRALKHLSTACVSDMYKLTQGKLAIIATGGVESGRDALDKIEAGASLVELYSSMVYIGPQVARRVKNELYH
ALNEKGYKDVAAAVGRKHKHVPEKKLQAPKFD

Gene-Specific Links for TGME49_010790

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins