ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_010780 ()

ubiquitin carboxyl-terminal hydrolase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_46366

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PBANKA_121960 cg1 protein, putative
  • TGME49_010780 ubiquitin carboxyl-terminal hydrolase, putative
  • NCLIV_012050 ubiquitin carboxyl-terminal hydrolase, putative
  • cgd1_2870 N-terminal domain cerevisiae Yos9p-like that is involved in GPI-anchored protein transport in the golgi, a cation independent mannose-6-po4 receptor like conserved Cys motif and a C-terminal E. coli y
  • Chro.10321 cg1 protein
  • CMU_029680 hemimethylated DNA binding domain-containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_010780 ubiquitin carboxyl-terminal hydrolase, putative
MHAEGHSSRQLPSTSAEPLVWSFCSAPHAQVPYAAGRPTAQAAFPYGAHAAVSSDGSFVPAQLSSADGACGALPGVSTPG
YTAFACSASAQEGARNLRCDMPATRSGGDTPSLAHGGSWPVQARGLYTGEGGNFWLPVSRPDAQAAQVHGLSQAVQRSVL
ARDTAPFASSHAFSGQNAFAEGSSQVQATAEVRPPTSVSSSGAEVPTFAFSSDPGAVNHSGGFLPAPQNLTGSFLRQEEA
SRVAFAGAGDAASTCTNRSRETLGSGRAAPGSRDGGNADAVSDQNRGGEEHCPLPSLAFAGTAARDVHCASEPPSLAERL
GGGKAGDAGVYVHPGETNRGATGGFKLPPHAPETPFSQAIPTKCVDARGFITHSEEVMIGVERPNASQRQRTIPDAAHQL
GDHASGVHTPGAVLTADPPSWHGGAPVPAPFVHPSVVQPLTENGFHVPAGEWSRSRPQAHRRDSGLHACTDFASPPCPHP
LAEVPRHATDVCRPLSWSERRTDALLARTEECPPELSPAPKKRRRIKKDKVPSTSATQTGSFSSASDSRTHEPAPTGAKV
KRIRPATAAAGSNTRQLQMHPPEVLSFSPSEDTPEKRTKEKPRSPEVGHERIGDAALGVPAPPEGRNSVNAPDGVGASSS
QERSEFITERQEEAAATQSSAATASVSIQRSQAVAPEPPLGPPAPADSSQLPSASSVSLPTAAALTRSLCVSPALPSAPS
SSPSSSDPSDPSPSSKADGPQALRDASPGESREAVPPSASLNEPHDPRELHAQASSISASLETVVPRSRVRARPRSLFGN
CRRPGRRPRRPERGGEPERGASLVKTVEGSGAPGVPCSRSPSVHARSSPACVVVGYGAVMPTREVAGNSLMGLINLGGGS
CFLNAVLQCLANCQPLRDFYLQWAETLPPRELLGRQYAVYTKHLERLAPFSRRRVKRRPQEERGAVCTSISWELATVINH
MWRQSGSVKFLKPDALYQACCRIMPDFDPHEMQDSDEFLRLLLDILDAELRAAVLQLPLEDVLLLQRRPTKWQSDDGSPQ
VPGSEAASSRTGSVSTLETPPMSDVVSSGSGSPSSPSASHAASPVSSPLPRSSTALHTEASALPPPVKGVRRSADAARER
ASAASATACASSEAACASLPRALQEAYRARVKQEATVDSEGVSGSRESRPLTKAEAGTLPNPEEKSAHKREESTTSGEKA
APRVTSSTVDAVQTLFSLVFEGGEVDEVRCSACGRRTATLVPFKSLAVAMTQEAQQQACYYSSMRAKPATFSSELVPVDL
VECLDRHFADDADSLKLSTGEGYFCCRCQRKQDAVKRCCLVKDHLPFVLCLTLKRFVRGHDTYKIWNPVRFGEFLDLSKY
VRSDAFPAPTGTEKQPGGAADPAGAGGDIRSGRVSWSASGDSADAKMERGGEAASALAPVGTPGGKQGQECGGGPTAIQA
KVEQKSQCEFPRLSGGLSLCSEPGEWSASRYAASTAAWRGPDAPGAVAASLPRGALSLSACSSSAGGRTSTGDSSQADSP
PAFRDRQAPTLACMEAGRPAGGAEAKASMAGSPASGLEGIRSRDGRDTWTHMSESSEAESAMKREKNEGEASGDSRSACK
SDTRDPESSLYRYCLVALIEHEGPATDQGHYVCYVKHLETGQWFKADDKLITLVDLSQVLAAAPYMLFYERVRTSESMRS
YPFFVSDEASVRSEKHEQGDTHAEGDTEGASSSTFGPENRKARAWRRCDWSSWTQRVKEISVPSDLFADDDSGGPSSSCT
RQPSPERSPGDSDTRGLSPASAMSGSSGRRARSEAPGGVPPSLFSSSCASQALAAAGKAPRAAGGRAGLREAVGASSGAV
RSRVGVSSSRGASCTSASGAAAPEGHGSFSPEAACRARDLSGESEGGSTVAEVAAAQVRREQTRTHASVEDGSQVGARQS
GECFLWSSERAFLTLACSSTFLCSCVQREPTFAPTPTSPQGSTEPASRGRPETQRPSEKAFPRRVGLLEPEHVSTLPPAS
EAAPFGSAGSIRVLSGGETEAKVRSLSQMERTERKRGAVEAPPRRRASVEGGGMGLTAADREVRRQVEASLLTEAVNYQI
EKGRESSRGKAPSPTCESAAGAGTDGKVAEVKSFLPREKSVFLGEGSEEEAKRSGSFQKNEKDTDTACITSVKGVAAVDP
CGGVCPVSKPDVSQKAFSETSEPPDRQSGLGSTASKAFAATPQRPSEVSLPAPDSGAGVAVSPPLWTGAQPSSCAVSGFA
VSASKPENAVPISTPGWHVLHASTSFPQGPPAFQGDSYLREGFAPAARLPGGSSVSSSGGNPVDSPHVTHGGPPLGDSWK
VQPGAHPPHVVWGSQGIPESRLHAYPRADGSQQGFAVQVAADLQSAQTPGFSTQWLQETTRSAEETVRTGTGAPPTAGTP
LAVKGGGPQVSLDSREGQGRRREGSGPPAETGAPVWPVGERPVDGGTAGATWKQATEIEGLSAKPQVASARPEENIGPGG
VDIAPASSVASHADPVAPSSGVDSASAPEDAQAAAKAAAAEKAAKRRRRARQLQQQNRRLKNAEAAEVEAAAAHAALPSV
GGGREPVAHAAEMGLAASEAARGGISTTAPGSGIFPQQQTQAGQAYVGVVPYPGAAGREVPHGHPGVAFSEGFAVTPACA
PLPQGLPGQGYRAGGQQLGTSTLYTWSGAPGKLYGQGTSHVSSPSLPQLQSHAVQWNASFSVAAAALQEAAAAAATDAGA
QGEAAKPVAAPTPPRRRKKNGSAPETAGAARVEGLSVSIQGGVSQPVGGWNPSQHLPQGPLLSGTALGPNPTVSRSEVDH
GRGAVGNFQAPSQPGMSDYLGVHMQVLGASGASGAGDCRAVFASQVPCAGTSSGPRSGEPQFPGACGGAATSASFYGSDG
AFSSSAPVMGHLPSVAGPQGFLPSATAEQARAPVPCGESVQPPKKPPRKRPPANKAVQPQAQTEIALSASQPSACAGTLG
EKHSEFSTPHGHLRQDGFESSSNSVGTSWALQTTPDSAAGRPREMQRQGVSKPHGLASAPPSLPQTCAVPMGYKSGPFPQ
PSLHALPAAVTGGTQGFTGGVCTHCGRPATATEQGFQPSCSCATRFFSASREGFAAQSGVTTAGATWPSHVFPGERNPSG
DLLPQARPAHAAIGEERVLPQPAFVGTVDSNQQLQLNYPSTQYGWPASAGRGTNPSASGFVASHFPAQPSPRGAERQGPG
APAAAVPAHQLGVAWGTQARAPAVQCMQSSSSGRAGGVSAEAKKRSRKKKPSAQDASVMKSSQQPGEVASDAGVAATVEA
ARLNPASQAHDIAFQECSPAAPRAKSRATKSVDKPEPSVSSERLTGTPEAIARVFTDEHSLQGMPATQLVQASGSHAPCP
RQTHQYYPGDLMSKGHGDRRDHTSATDQSWAGGTFRGFQNHVEPVSPVKATSAQESFVRGQQTEGQSYAWGWTGASVGGT
SCHQTNFHGAAQPAMVQAFGSTAVSQVLPSTVPGSRDGRGHFENNGLQTRPAMGVPLPNSESVYHHGGVAVTHLPASGEA
LLQQQQQHAVYAGSTVPKTQNVFQEDARQYSTGMSISGPAFSHGLRAVQSMPTVNYNKVPEAGRLGAPAPANHPEGAAAG
MICVSAPSHVGMDAQHFPPGVVSAGGFYQAGYKSSQRFFVDGAGEPMRTRPPASRLSRVVHHCVVFLSCACFLSLRMEDF
LSIAHGNPLDGPMAETPRWHPAEWEAVLGNMESAVLKIDFSQSLGNWASIREQSTFNVTMADSTVVCTHPQRRDDDLFME
FPQSTQNAKSNGLTPKRADAEPKRLVSAFPEMRDYLRTARLRWIVDRCFQFKDGDASEWTYEICVGKKVTQFAGNQKAGK
TIGKTLFEWGTYKIGHDQLWANGTLTQIYGNGTGGRQTEVFFECLDQYPTVTAIEEVRESELRMWVGASMFCDFRPTNPT
PPLLEALLRPLEGWCANFTTTGFWSYEYCHPDSLVQFHKDSSGDVRDPMFLLGTLHTSTPSSTFMWKTHASADFPMLRGK
GAGVNTNSRPKFRFLPVQLVDFPSELNRGREEKPQQVLAMELTKGTLCDSADVQRSTRVLFECPDDFATLATHQVMKVME
TSPCHHELLIHTPLVCPHPRLLPPRPKEPQQVNCVPVESHHLNGSHFGMRQYKRSRSSRKSPAFRVGRLVRHRWSKYTAV
VLSWDRSCEAPPDWTAKVYEHYPESSSHKPHYLLLVDQAAVREPQLPLFAYVPEVALEPAPAGQGLFRHPLTSYFFHHFS
THSGHFVPLMNTTIPQMFPEDFSEASQAIKIGISELNDKLASSLGVSHADISDRPQVIGFTP

Gene-Specific Links for TGME49_010780

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins