ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_009910 (H2Bv1, h2b)

histone H2B variant 1, a gene from Toxoplasma gondii

Compiled localisation
nucleus during extracellular tachyzoite and intracellular tachyzoite and tachyzoite mitosis
nowhere except nucleus during intracellular tachyzoite
not apicoplast during tachyzoite mitosis

Who localised this protein by microscopy?

Jammallo, L., Eidell, K., Davis, P. H., Dufort, F. J., Cronin, C., Thirugnanam, S., Chiles, T. C., Roos, D. S., Gubbels, M. J.
An insertional trap for conditional gene expression in Toxoplasma gondii: identification of TAF250 as an essential gene. (2011 Feb, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

nucleus
  • "Expression of a tubulin promoter driven C-terminal YFP fusion of gene 72.m00683 co-transfected with a H2b-mRFP fusion proteins identifies nuclear localization."
  • Microscopy type: fixed light
  • Microscopy method: RFP tag
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: nuclear
  • Other genes localised in this publication: hypothetical protein

Dalmasso, M. C., Onyango, D. O., Naguleswaran, A., Sullivan, W. J. Jr, Angel, S. O.
Toxoplasma H2A variants reveal novel insights into nucleosome composition and functions for this histone family. (2009 Sep 11, J Mol Biol) PubMed / full text
   more detail about this publication

nucleus

Frankel, M. B., Knoll, L. J.
Functional analysis of key nuclear trafficking components reveals an atypical Ran network required for parasite pathogenesis. (2008 Oct, Mol Microbiol) PubMed / full text
   more detail about this publication

nucleus during extracellular tachyzoite
  • "We co-stained with either 4',6'-diamidino-2-phenylindole or T. gondii histone H2B (Dalmasso et al., 2006) to indicate the nucleus, and heat-shock protein 90 (Hsp90) as a cytosolic marker (Echeverria et al., 2005)."
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: Pru HXGPRT-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: nucleus during extracellular tachyzoite
  • Other genes localised in this publication: GTP-binding nuclear protein RAN/TC4, putative, heat shock protein 90

Dalmasso, M. C., Echeverria, P. C., Zappia, M. P., Hellman, U., Dubremetz, J. F., Angel, S. O.
Toxoplasma gondii has two lineages of histones 2b (H2B) with different expression profiles. (2006 Jul, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

nowhere except nucleus and nucleus during intracellular tachyzoite
  • "As expected, indirect immunofluorescence (IIF) assay performed on fixed tachyzoites-infected HHF using this polyclonal antibody showed only nuclei fluorescence (Fig. 2B)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: nucleus and nowhere except nucleus during intracellular tachyzoite
  • Comment: strain information not found
  • Other genes localised in this publication: -

Hu, K., Roos, D. S., Angel, S. O., Murray, J. M.
Variability and heritability of cell division pathways in Toxoplasma gondii. (2004 Nov 1, J Cell Sci) PubMed / full text
   more detail about this publication

nucleus and not apicoplast during tachyzoite mitosis
  • "Apicoplast DNA is also visible (arrows) labeled with DAPI only (red), not with H2b-YFP. In all other regions, the H2b-YFP distribution corresponds precisely to the DNA distribution stained by DAPI."
  • Microscopy type: Light
  • Microscopy method: YFP tag
  • Strain: RH
  • Gene model mapping comments: blast from primer GTCAagatctATGTCAGGGAAAGGTCCGGCACAG, annotation matches
  • Localisation record: nucleus and not apicoplast during tachyzoite mitosis
  • Other genes localised in this publication: membrane skeletal protein IMC1

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10044

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_009910 histone H2B variant 1
MSGKGPAQKSQAAKKTAGKSLGPRYRRRKRTESFALYIYKVLKQVHPETGVSKKSMSIMNSFINDIFDRLADEAVRLIRY
NKKRTLSSREIQTAVRLLLPGELSKHAVSEGTKAVTKYTTSGA

Gene-Specific Links for TGME49_009910

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins