ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_009710 (L28)

50S ribosomal protein L28, putative, a gene from Toxoplasma gondii

Compiled localisation
apicoplast during tachyzoite

Who localised this protein by microscopy?

DeRocher, A., Hagen, C. B., Froehlich, J. E., Feagin, J. E., Parsons, M.
Analysis of targeting sequences demonstrates that trafficking to the Toxoplasma gondii plastid branches off the secretory system. (2000 Nov, J Cell Sci) PubMed / full text
   more detail about this publication

apicoplast during tachyzoite
  • "The first 159 aa of S9 and the first 143 aa of L28 also efficiently targeted GFP to the apicoplast"
  • Microscopy type: Light
  • Microscopy method: GFP tag
  • Strain: RH
  • Gene model mapping comments: blast from the primers LA1s, LA2a (1-143 residues). Also 4.3 annotation matched up
  • Localisation record: apicoplast during tachyzoite
  • Other genes localised in this publication: ribosomal protein S9, putative, acyl carrier protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_13743

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PFE0145w organelle ribosomal protein L28 precursor, putative
  • PBANKA_110270 organelle ribosomal protein L28 precursor, putative
  • PY04664 ribosomal protein L28, putative
  • PVX_097655 50S ribosomal subunit protein L28, putative
  • PCHAS_110240 organelle ribosomal protein L28 precursor, putative
  • PKH_103050 50S ribosomal subunit protein L28, putative
  • NCLIV_003980 50S ribosomal protein L28, related
  • TP02_0680 60S ribosomal protein L28, putative
  • TA14535 50s ribosomal subunit protein L28, putative
  • BBOV_II007060 50S ribosomal subunit protein L28, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_009710 50S ribosomal protein L28, putative
MQRPRSGRVCVYLVTNVLLALSIWLSRASAFRLSRWSASALCPAQSPSCVGTAHRLSTPLIAAGCQLGSFPSGCTNEFFW
RRHGSQTALGISSRRHLQVIRRKKYRTKGTSTVRRHYGIKGRGGGKLRLGKHTGVPLQAMECPARRCMLLGKMDNTKARN
RSHSRVATHKVQRLNLHWKRLWWPEAGYYVRLRLSVKGIRTIKKYGLQRAADKFGLNLKKKKYYAGYSHRRMVSRLSLAG
GTAGHINADEIAGPLSGQRETSTIARVDAAKM

Gene-Specific Links for TGME49_009710

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins