ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_009570 (XPMC2)

exonuclease domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
not centriole and nucleolus and nucleus during tachyzoite

Who localised this protein by microscopy?

White, M. W., Jerome, M. E., Vaishnava, S., Guerini, M., Behnke, M., Striepen, B.
Genetic rescue of a Toxoplasma gondii conditional cell cycle mutant. (2005 Feb, Mol Microbiol) PubMed / full text
   more detail about this publication

nucleolus and nucleus and not centriole during tachyzoite
  • "TgXPMC2-YFP localized to the parasite nucleus and nucleolus which is consistent with the expected subcellular localization of critical mitotic factors. Localization of TgXPMC2–YFP with anti-GFP antibodies demonstrated that the fusion protein was concentrated in a body that is distinct from the centrosome"
  • Microscopy type: Light
  • Microscopy method: YFP tag
  • Strain: RH
  • Gene model mapping comments: Blast from AY841997
  • Localisation record: nucleus and nucleolus and not centriole during tachyzoite
  • Other genes localised in this publication: fibrillarin, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12649

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_009570 exonuclease domain-containing protein
MVTESHSHSGLAKRGGSIHRSQGRGDGHSNQQLRQLFNHSRTRRIQGGPSIVRPPAPAVSLDCEMVGCGPDGNISALAQV
SICDEKGEVLLDEFVMPDMRITDFRHHVTGLSWSILRDRGISFNAARTLVTDIIRGKVLVGHALQHDLQVLALDHPVHMI
RDTSKYKPLRPPGLARNAVPSLRRLTSHWLNREIQTGIHNSVEDCRAAMDLYRKFQSQWERQFLAVNDAQNSLTSIEYLE
DKLDHESGTLQTANTPGQAPRKRARSDHGVARQRGSEVYDSDDSGTSEAATVVASESSHPSSNVSAQGRKRQRSVENGAR
DGVSGYDRTKDADGFPGIDLSGLTKKERKKLKRKLCLGRRG

Gene-Specific Links for TGME49_009570

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins