ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_009150 (NDH2-I)

mitochondrial alternative NADH dehydrogenase 1, a gene from Toxoplasma gondii

Compiled localisation
mitochondrion during bradyzoite and tachyzoite

Who localised this protein by microscopy?

Lin, S. S., Kerscher, S., Saleh, A., Brandt, U., Gross, U., Bohne, W.
The Toxoplasma gondii type-II NADH dehydrogenase TgNDH2-I is inhibited by 1-hydroxy-2-alkyl-4(1H)quinolones. (2008 Nov, Biochim Biophys Acta) PubMed / full text
   more detail about this publication

mitochondrion during bradyzoite and tachyzoite
  • "TgNDH2-I and TgNDH2-II are constitutively expressed in tachyzoites and bradyzoites and are localized to the mitochondrion as shown by epitope tagging."
  • Microscopy type: Light
  • Microscopy method: myc tag
  • Strain: RH
  • Gene model mapping comments: blast from DQ211932.1, annotation matches
  • Localisation record: mitochondria during tachyzoite and bradyzoite
  • Other genes localised in this publication: pyridine nucleotide-disulphide oxidoreductase, putative

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10452

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_009150 mitochondrial alternative NADH dehydrogenase 1
MAGQWLRLLAGASVPMLSLPARCDSPASPSSPSSPKERVSALLAQPPRPFSAFSPVSTWMSTKWTSFRLRTGLLSPAAVA
ASAVASASPAAREAPARRQKVVVVGSGWAAVSFLADLDMTRYEPVVISPRDYFTFTPLLPSVCVGTLPASACMTGVRELL
VRGGVPCGSFYEGRVAEICPTEKKVRCQSTHGKAQDAREWEESYDYLVVAAGADVNTFGVPGVKENAFFVKELEDARRLR
SALFDVIETASVPGVSEEEKKKLLHFVVVGAGPTGVEVAAEIDDFFQAEGATHFPQLRPLVRITVVEMLPTVLAAYNNDV
QAFAKRLLEENPRVDLCLQSQVVGVGPDSVKVRTKRADGQVEEKEMPCGLLVWASGIKSPKVCLDLARKTAELREAQQQS
PVILVDQQMKVRGCEGVYALGDCCRLSPPPLVQHADTLYEAATANGAASTDWLEREAPKLSTVFPQLASSKYDFSQKPRQ
TQMTKEQFVKLLADIDAAYRAPAPTAQNAKQAGRYLAQTFNAFPSVEEKRRAPAFVNQTRGALVYLGHGQAAADIEGWRT
FLGGAATLLLWKAAYLQMQLTLHNAVACLGGWLRTSLVGRAVCREHLDGETVYGDRRK

Gene-Specific Links for TGME49_009150

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins