ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_009130 ()

regulator of chromosome condensation RCC1 domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11863

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0385 UVB-resistance protein UVR8 homologue
  • PBANKA_091130 UVB-resistance protein UVR8 homologue, putative
  • PY01216 UVB-resistance protein UVR8
  • PVX_092485 hypothetical protein, conserved
  • PCHAS_071260 UVB-resistance protein UVR8 homologue, putative
  • PKH_093520 conserved Plasmodium protein, unknown function
  • TGME49_009130 regulator of chromosome condensation RCC1 domain-containing protein
  • NCLIV_003540 Hect E3 ubiquitin ligase, related
  • cgd6_2770 uvb-resistance protein uvr8, putative
  • Chro.60319 uvb-resistance protein uvr8
  • CMU_007070 regulator of chromosome condensation family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_009130 regulator of chromosome condensation RCC1 domain-containing protein
MTTLKSWPLFSESSPLGFESTGEARFLVSLHAGNEEMGQAATKSGVVIWGAPETTALLSASGPGSAASSGVSPPAASLSS
ASANASPLAGSAPAATPLGGESSSFSASPALAVFAETSEEMASPRLVDALKNINSERVSAGGMQMAVVAHSGELYMWGAN
SEGQLGTGDRRDASVPRLVKALHGKVVKAVACSQEHTVCCLDDGSAYAWGCALNGRLGLHGLSIPSSAGLGVFSPATGAR
PEPLASACAVCTPRVLESLCGYFIADVACGPYHSAFLGIYEQDRTSLFTCGLGLNGRLGHGDEEDRHLPTAVHALENVNI
TAIACGAHHTACVTSAGTLYTWGGAAFGKLGLGSTRGSQLLPKHVSGPLRNKAVVSVALGSQHSACVTTDGELYTWGQGR
RGNLTRFFRGAWRRSLVSSSSTSFAETPTLHASSKTILGHGDPEVPPNRPACLRALNGKGVVQLSCASTFTVAFCDPQRV
SAKATAAAAADVAACAAGVSVSDALGSSGAASVEAPALLKPSASGEKRDAGAESGTLRSSTKGDEEALATCAGVDAGGAS
LRPRGASACRKTGSAAFPRVAGDADVSGATAGRAELEALGSTTAVTAPSAAGRLSPLPSAERDELLCEVGTISAALQAAQ
QENLLLVALLSGTAQQLREVLQRNALLERELDAMRKSSSDAGDRLATLREHYMQQIQQLQEQLAQQDTRLHAILASRGSQ
LLSSQGLLSRAFARPLPSSGASPPLSASSSAPLAVSAVDPGGQAFTPSSRASGAVAPGVSGAPEALTALPEETLEEALLD
PLGQQPPPSRFLSFPSSPAFLPSQGVSPGGASSPRAARAASGVLGSTSPGASGSPETPPEAQGRSSKLLRQALGLGETPF
SAHGLRVGREGRKRGGSLALFKSRGRDFLSQGLFADEAAAPSPLDAKKGENNGLALVPSQGDPSWASLLLTSSVDSGASA
RRHLSLEPSSVSGRSRGGARDKSGGLEGRSRGSSQSARVVTEGSSIPVFFLEEEM

Gene-Specific Links for TGME49_009130

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins