ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_009030 (ACT1)

actin, a gene from Toxoplasma gondii

Compiled localisation
cytoplasm
cytosol during tachyzoite

Who localised this protein by microscopy?

Gordon, J. L., Beatty, W. L., Sibley, L. D.
A novel actin-related protein is associated with daughter cell formation in Toxoplasma gondii. (2008 Sep, Eukaryot Cell) PubMed / full text
   more detail about this publication

cytoplasm

Sahoo, N., Beatty, W., Heuser, J., Sept, D., Sibley, L. D.
Unusual kinetic and structural properties control rapid assembly and turnover of actin in the parasite Toxoplasma gondii. (2006 Feb, Mol Biol Cell) PubMed / full text
   more detail about this publication

cytosol during tachyzoite
  • "Expression resulted in accumulation of His-TgACT1 in the cytosol of SF9 cells as revealed by specific6antibody staining (Figure 1A)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain:
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytosol during tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10066

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_009030 actin
MADEEVQALVVDNGSGNVKAGVAGDDAPRAVFPSIVGKPKNPGIMVGMEEKDCYVGDEAQSKRGILTLKYPIEHGIVTNW
DDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANRERMTQIMFETFNVPAMYVAIQAVLSLYSSGRTTGIVLDSGDGV
SHTVPIYEGYALPHAIMRLDLAGRDLTEYMMKILHERGYGFTTSAEKEIVRDIKEKLCYIALDFDEEMKAAEDSSDIEKS
YELPDGNIITVGNERFRCPEALFQPSFLGKEAAGVHRTTFDSIMKCDVDIRKDLYGNVVLSGGTTMYEGIGERLTKELTS
LAPSTMKIKVVAPPERKYSVWIGGSILSSLSTFQQMWITKEEYDESGPSIVHRKCF

Gene-Specific Links for TGME49_009030

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins