ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_008030 (MIC4, MIC 4)

microneme protein MIC4, a gene from Toxoplasma gondii

Compiled localisation
microneme during bradyzoite and intracellular tachyzoite and merozoite and sporozoite and tachyzoite
wall forming body during macrogamete

Who localised this protein by microscopy?

Sheiner, L., Santos, J. M., Klages, N., Parussini, F., Jemmely, N., Friedrich, N., Ward, G. E., Soldati-Favre, D.
Toxoplasma gondii transmembrane microneme proteins and their modular design. (2010 Jun 9, Mol Microbiol) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite
  • "Double immunofluorescence analysis by confocal microscopy of intracellular parasites transiently expressing MIC16-Ty carried out with anti-Ty-1 (green) and anti-MIC4 (red), a micronemal marker."
  • Microscopy type: fixed light
  • Microscopy method: antibody directly to protein
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during intracellular tachyzoite
  • Other genes localised in this publication: hypothetical protein, dense granule protein 3, gorasp2-prov protein

Sheiner, L., Dowse, T. J., Soldati-Favre, D.
Identification of trafficking determinants for polytopic rhomboid proteases in Toxoplasma gondii. (2008 May, Traffic) PubMed / full text
   more detail about this publication

microneme during tachyzoite
  • "In stable parasite lines, R1NtR5 NtTy only showed accumulation to an apical compartment exhibiting partial colocalization with a typical microneme marker (TgMIC4) but mainly concentrated in a post-Golgi compartment (Figureᅠ6B)"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH hxgprt-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during tachyzoite
  • Other genes localised in this publication: rhomboid-like protease 4, rhomboid-like protease TgROM2, rhomboid family domain-containing protein

Dowse, T. J., Pascall, J. C., Brown, K. D., Soldati, D.
Apicomplexan rhomboids have a potential role in microneme protein cleavage during host cell invasion. (2005 Jun, Int J Parasitol) PubMed / full text
   more detail about this publication

microneme during tachyzoite

Hoff, E. F., Cook, S. H., Sherman, G. D., Harper, J. M., Ferguson, D. J., Dubremetz, J. F., Carruthers, V. B.
Toxoplasma gondii: molecular cloning and characterization of a novel 18-kDa secretory antigen, TgMIC10. (2001 Feb, Exp Parasitol) PubMed / full text
   more detail about this publication

microneme

Reiss, M., Viebig, N., Brecht, S., Fourmaux, M. N., Soete, M., Di Cristina, M., Dubremetz, J. F., Soldati, D.
Identification and characterization of an escorter for two secretory adhesins in Toxoplasma gondii. (2001 Feb 5, J Cell Biol) PubMed / full text
   more detail about this publication

microneme during tachyzoite
  • "In wild-type parasites, T101F7 mAb anti-MIC1 and polyclonal anti-MIC4 showed perfect colocalization of the two proteins and a typical apical micronemes staining"
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during tachyzoite
  • Other genes localised in this publication: microneme protein MIC1, microneme protein MIC6, SRS29B (= SAG1, P30)

Brecht, S., Carruthers, V. B., Ferguson, D. J., Giddings, O. K., Wang, G., Jakle, U., Harper, J. M., Sibley, L. D., Soldati, D.
The toxoplasma micronemal protein MIC4 is an adhesin composed of six conserved apple domains. (2001 Feb 9, J Biol Chem) PubMed / full text
   more detail about this publication

microneme during bradyzoite and merozoite and sporozoite and tachyzoite
  • "Here we show that MIC4 localizes in the micronemes of all the invasive forms of T. gondii, tachyzoites, bradyzoites, sporozoites, and merozoites."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AF143487, annotation matches
  • Localisation record: microneme during tachyzoite
  • Comment: disruption of TgMIC6 results in mistrafficking of TgMIC4 and TgMIC1 to dense granules, the “default” secretory pathway
  • Other genes localised in this publication: -
  • "Here we show that MIC4 localizes in the micronemes of all the invasive forms of T. gondii, tachyzoites, bradyzoites, sporozoites, and merozoites."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: ME49
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during bradyzoite
  • Other genes localised in this publication: -
  • "Here we show that MIC4 localizes in the micronemes of all the invasive forms of T. gondii, tachyzoites, bradyzoites, sporozoites, and merozoites."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: VEG
  • Gene model mapping comments: inferred from another publication
  • Localisation record: microneme during sporozoite and merozoite
  • Other genes localised in this publication: -

Ferguson, D. J., Brecht, S., Soldati, D.
The microneme protein MIC4, or an MIC4-like protein, is expressed within the macrogamete and associated with oocyst wall formation in Toxoplasma gondii. (2000 Oct, Int J Parasitol) PubMed / full text
   more detail about this publication

wall forming body during macrogamete
  • "The macrogamete is characterised by two types of structurally distinct wall forming bodies (WFB1 and 2). However, by immuno-electron microscopy, it was possible to identify two populations of dense granules (WFB1) which appear to form sequentially during macrogamete development. The first granules to form (WFB1a) stained positively with anti-MIC4 and were followed by MIC4 negative granules (WFB1b)."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: M3
  • Gene model mapping comments: inferred from another publication
  • Localisation record: wall forming bodies during macrogamete
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_114123

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_008030 microneme protein MIC4
MRASLPVHLVVCTQLSAVWFGVAKAHGGHRLEPHVPGFLQGFTDITPAGDDVSANVTSSEPAKLDLSCVHSDNKGSRAPT
IGEPVPDVSLEQCAAQCKAVDGCTHFTYNDDSKMCHVKEGKPDLYDLTGGKTASRSCDRSCFEQHVSYEGAPDVMTAMVT
SQSADCQAACAADPSCEIFTYNEHDQKCTFKGRGFSAFKERGVLGVTSGPKQFCDEGGKLTQEEMEDQISGCIQLSDVGS
MTADLEEPMEADSVGACMERCRCDGRCTHFTFNDNTRMCYLKGDKMQLYSSPGDRTGPKSCDSSCFSNGVSYVDDPATDV
ETVFEISHPIYCQVICAANPLCTVFQWYASEAKCVVKRKGFYKHRKTGVTGVTVGPREFCDFGGSIRDREEADAVGSDDG
LNAEATMANSPDFHDEVECVHTGNIGSKAQTIGEVKRASSLSECRARCQAEKECSHYTYNVKSGLCYPKRGKPQFYKYLG
DMTGSRTCDTSCLRRGVDYSQGPEVGKPWYSTLPTDCQVACDAEDACLVFTWDSATSRCYLIGSGFSAHRRNDVDGVVSG
PYTFCDNGENLQVLEAKDTE

Gene-Specific Links for TGME49_008030

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins