ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_007900 (ORF25.m01787)

transcription factor IIIB subunit, putative, a gene from Toxoplasma gondii

Compiled localisation
nucleus during intracellular tachyzoite

Who localised this protein by microscopy?

Upadhya, R., Kim, K., Hogue-Angeletti, R., Weiss, L. M.
Improved techniques for endogenous epitope tagging and gene deletion in Toxoplasma gondii. (2011 May, J Microbiol Methods) PubMed / full text
   more detail about this publication

nucleus during intracellular tachyzoite
  • "IFA of clone B6 (epitope tagged clone) demonstrated nuclear localization of the protein (Fig.οΎ 4), consistent with the identification of ORF 25.m01787 as an RNA polymerase III transcription factor Brf1"
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: nuclear during intracellular tachyzoite
  • Other genes localised in this publication: -
  • "IFA of clone B6 (epitope tagged clone) demonstrated nuclear localization of the protein (Fig. 4), consistent with the identification of ORF 25.m01787 as an RNA polymerase III transcription factor Brf1"
  • Microscopy type: fixed light
  • Microscopy method: 3HA tag
  • Strain: RH
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: nuclear during intracellular tachyzoite
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11162

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_007900 transcription factor IIIB subunit, putative
MRLLRLGLLNLCGTVLEDLTLVDGLQFAESSSGGVSMVGQFVSSCTGAGRGLRAGVGGGGDSREQTLQRGFNNIQSIAER
LRLSSQQHISSAHRLYLMATQRNFTLGRRSVLVASACLYAICRRERTPHLLIDFCDVLRTNVRALGQVFMKLLRVLHLQV
PHVDPSLFLERFACQMQLGDKTHTVAQTGVRLIQAMNRDWISTGRRPMGLCGAALLIAARYHNFQMNAEDIAHIVRVSGP
TVNRRLQEFKQTATAQLAVADFESTDLLSLPSQAQPPCRIKAYRRKLKLMQKKEEETLALTDSPAVPALPSTVPEEKKAR
MRSEEESDEPAEANGAEQGENGESNRRETEEGEDVSLATVCGDSGPKRFAEFAAVGNLHLDTELLCKEAPSPEDILMLAG
RMASALDGRVQSNLSQSTSASCREDFGTQTDVSLDASVAGESRDTHRTAGESGGAEEGRTLSLDASGTGQAGSEDLPPPS
GTHGCRLRCSDVPASASSSASSSVSSSSASSSILSGVVSRASCEDSEESRSVRSGGGRFGDTETVGSTERGEEDDDSAEE
EIRAMFLSESEQRAKALIWDELTKDVMPLVHRRLKEKKLREREMMLNQSKRKRLQSTGRRSRFGSDAGSAPAASAAESVR
LALQMSSRSIVGKINDDALNSLFGPVRRVTEQNGN

Gene-Specific Links for TGME49_007900

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins