ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_007690 (PDCD5)

double-stranded DNA-binding domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
cytosol during intracellular tachyzoite
apical and rhoptry and vesicle-like structure just under the parasite membrane

Who localised this protein by microscopy?

Bannai, H., Nishikawa, Y., Ibrahim, H. M., Yamada, K., Kawase, O., Watanabe, J., Sugimoto, C., Xuan, X.
Overproduction of the pro-apoptotic molecule, programmed cell death 5, in Toxoplasma gondii leads to increased apoptosis of host macrophages. (2009 Sep, J Vet Med Sci) PubMed / full text
   more detail about this publication

cytosol during intracellular tachyzoite
  • "Immunofluorescence microscopy revealed that overproduced TgPDCD5 with a hemagglutinin tag was localized in the cytosol, which was consistent with the localization of endogenous TgPDCD5."
  • Microscopy type: Light
  • Microscopy method: Polyclonal antibody to whole protein, Cterminal HA tag, HA tag after 106 amino acids
  • Strain: PLK-WT
  • Gene model mapping comments: inferred from another publication
  • Localisation record: cytosol during intracellular tachyzoite
  • Other genes localised in this publication: -

Bannai, H., Nishikawa, Y., Matsuo, T., Kawase, O., Watanabe, J., Sugimoto, C., Xuan, X.
Programmed Cell Death 5 from Toxoplasma gondii: a secreted molecule that exerts a pro-apoptotic effect on host cells. (2008 Jun, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

apical and cytosol and rhoptry and vesicle-like structure just under the parasite membrane
  • "Although signals recognized by the antibodies were distributed throughout the parasite body, the strongest signals were detected in the apical end of the parasites, especially near the rhoptries (Fig. 3C). Other strong signals were located within vesicle-like structures just under the parasite membrane."
  • Microscopy type: Light, EM
  • Microscopy method: Polyclonal antibody to whole protein
  • Strain: RH
  • Gene model mapping comments: taken directly from publication, annotation doesn't match
  • Localisation record: cytosol and strongest near rhoptries and apical and strong vesicle-like structures just under the parasite membrane
  • Other genes localised in this publication: -

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11059

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_007690 double-stranded DNA-binding domain-containing protein
MVTSPVKGGRLSFSRPRTQLTFPVLRISHQFLRSQLLFVTRDACYSFSVPTLKERVPRSRLSACKKGFFLRGFLFLFSKA
YVSVIGFTVSTLEALLASELLEQVPPFSVFAWLRLTATPASENSCVKRRSTKHSQTCSLKNSPLRPKAKAAEAQEAMRQQ
MEEQRRIMLRAVLTPAAQERLHRIQLVKADKAREVEALILQNAQRGRLADKVDEATLIELLQQTSAASAAKNTPKVTVRR
DF

Gene-Specific Links for TGME49_007690

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins