ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_007160 (SAG2C)

SRS49D (= SAG2C), a gene from Toxoplasma gondii

Compiled localisation
host cell plasma membrane during bradyzoite
during not bradyzoite and not merozoite and tachyzoite

Who localised this protein by microscopy?

Saeij, J. P., Arrizabalaga, G., Boothroyd, J. C.
A cluster of four surface antigen genes specifically expressed in bradyzoites, SAG2CDXY, plays an important role in Toxoplasma gondii persistence. (2008 Jun, Infect Immun) PubMed / full text
   more detail about this publication

host cell plasma membrane during bradyzoite

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

during tachyzoite and not bradyzoite and not merozoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_54658

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_007160 SRS49D (= SAG2C)
MAAAHSAAACRYSTFWPCLLRERQSGTSSVSFVYPSQFLSLSLLVILTGSFAQQSAGNQANSQSVTCESNASPLVLRITS
KTNEVKFKCGTDLQLRENPAGSNKFWGNAACTKEVDASSVTFTSSPSPAKVAGNKGTEYSLALKNSSLPLSPFTVYFSCD
PPSTTGVGETGKAKVPASATTCIVQVSVFSQTAVTVPETNKCKNGQVTVAVTSKSKSVTFGCSEGATLKPALLDHVFIEK
ATEKSGGASTGREEEVVLQDLVPNSSLVENAANTGNDTVGYTLSCPDLPSSPQNIFYKCVSPASAREQVGTQTECKVLIN
IEEKPEAETPATPEPSRGEQGVVLGSAFMIAFISCFALVAGNMF

Gene-Specific Links for TGME49_007160

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins