ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_007130 (SAG2Y)

SRS49A (= SAG2Y), a gene from Toxoplasma gondii

Compiled localisation
parasite plasma membrane during bradyzoite
during not tachyzoite

Who localised this protein by microscopy?

Saeij, J. P., Arrizabalaga, G., Boothroyd, J. C.
A cluster of four surface antigen genes specifically expressed in bradyzoites, SAG2CDXY, plays an important role in Toxoplasma gondii persistence. (2008 Jun, Infect Immun) PubMed / full text
   more detail about this publication

parasite plasma membrane during bradyzoite, during not tachyzoite
  • "Parasites were switched to bradyzoites by use of pH 8.1 switch medium for 4 days. Coverslips were fixed, permeabilized, and stained with a polyclonal rabbit antibody against SAG2Y (red), with Dolichos agglutinin-FITC (green) reacting with the cyst wall, and with the nuclear stain Hoechst (blue)."
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: Pru
  • Gene model mapping comments: Taken directly from 18347037
  • Localisation record: surface during bradyzoite, not during tachyzoite
  • Other genes localised in this publication: SRS57 (= SAG3, P43), SRS29A (= SRS1), SRS29C (= SRS2, P35), SRS51 (= SRS3), SRS49D (= SAG2C), hypothetical protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_54658

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_007130 SRS49A (= SAG2Y)
MQQPVAKASEVQSCSGSATPLFLRLSSTNQEVKFKCGAGLQLRAKPENDEMLWGNAACTKEVDASSLIFTPPTSKTKSES
GYSLKVKSDALLKTPFTVYFLCDPTSSSGGDSGSKQVTGSGSSTTCLIQVSVFSQKPTPVPDANKCKDGQVALAITSTTK
SVTFGCNESATLEPRFFEHVFIEEQSQSSRAAATLEVKEVVLQALVPNSSLVENAAGTTATAVGYTLSCPNLPSSAQTFF
YKCVPPNPPSGGSGRTGTPEGCKVLISVEKRPDSDATATPAPSGGEQGVVLSSSFMIVSMSFAAMVAGNGFSAICC

Gene-Specific Links for TGME49_007130

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins