ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_007080 (MYST-B) *

* The amino acid sequence is recorded as differing between ApiLoc and the genome database. See the gene model mapping comments in each localisation for more information.

histone acetyltransferase, a gene from Toxoplasma gondii

Compiled localisation
cytosol and nucleus during tachyzoite

Who localised this protein by microscopy?

Vonlaufen, N., Naguleswaran, A., Coppens, I., Sullivan, W. J. Jr
MYST family lysine acetyltransferase facilitates ataxia telangiectasia mutated (ATM) kinase-mediated DNA damage response in Toxoplasma gondii. (2010 Apr 9, J Biol Chem) PubMed / full text
   more detail about this publication

cytosol and nucleus during tachyzoite
  • "Predominantly cytosolic distribution was also seen in transgenic parasites stably expressing ectopic fTgMYST-B (Fig. 2C)."
  • Microscopy type: Light, EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: blast from AAZ79483, gene model inconsistent?
  • Localisation record: nucleus and cytosol during tachyzoite
  • Other genes localised in this publication: SRS29B (= SAG1, P30)

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10222

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_007080 histone acetyltransferase
MQGRSDKRGTSPSGGGGAKKGESRETGTFSVEKDPWLPSSSYSDSSSESASQPRVPLSGSCQRPFAFSSRPSSHSSLSRS
GNFSRSRAAGSFSSQSPHSSRSSLNASNAAARNSSLASPRPAHSSFSSRHSSPFSRPSAVRPSRPSATSGSSSRSSSSAS
SSAASLSSSASSSSSSQSFPRQSRRVSTSPLPPVRDVPCSNSTFFSSASPQGFPSSRNRQEQRASPRSPRSTLSHSRSPP
ARRGKEDALDLSSPPSSQISEEGTRERTGKEAIRCSPNSPPGGHKRDEESERRREERRREGEDEIGSREEERGRGVEVRD
RTEEPRKGGDEERERVDGRSKFAEEEKRRQGEERVLSCDGAGERGRSDGEETSAEKREAKEETALKTDQDAPRERKEKDA
GGAREKSPGDREGRGEGVRRPGEEPRETTGKRTEHEESATGRDGGANEKKEKREEAQKKEKPSDKKSRPLRERGGRKSCE
EGKGDDETQSRLSLSSRISTREPRALAVHQWIGARLGHSFHPGKIISIRSIHSPASSLPFPNSPARRQRQHRGGRTCPSC
SKYMPGDSASPVCRRCGGVAPTLGAGRRAEAPELGRGARGPSARAEASPTSCGSTTAVGGAPKTPDGGPAPGEKGDRERV
AEVEKPHHYEYYVHYRHTNRRLDTWLKFDDLRPITPDGQVLEFPAVESRRRRRKRRRDADEDDDSGDETEPKRRRHDRDE
DAALSDVENERDEGESSDRDAEDEEDSDSEMLDKLAMFDPSVQFSDHDEEAAKEHEGMDLATLQAHEEATKIKTIRQIQF
GPFLLQTWYFSPYPAHVQDAEVLYVCEFCLSFFRHASELSTHNQRCILRHPPGDEIYREGRLSVFEVDGSVARVYSENLC
FLAKLFLDHKTLQYDVEPFLFYVLTEVDRTGCHLIGYFSKEKISLQAYNLACILTMPQHQRKGYGRFLISFSYLLSLREK
KKGGPERPLSDLGRLSYIGWWTWCLLTHMESDAQKRRRKISIEDLVRNTAVREEDIQRTLEEIGVLRYVQGHHLLLLHPD
LVKTRLKEAGSAGVLVHGENLRFVSYHRTPPAPREALPPPRRGEED

Gene-Specific Links for TGME49_007080

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins