ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_007060 ()

ribonucleotide-diphosphate reductase, small subunit, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10364

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_103660 ribonucleotide reductase small subunit, putative
  • PY03671 Ribonucleotide reductase, small chain
  • PVX_086155 ribonucleoside-diphosphate reductase small chain, putative
  • PCHAS_103740 ribonucleotide reductase small subunit, putative
  • PKH_134130 ribonucleotide reductase small subunit, putative
  • TGME49_007060 ribonucleotide-diphosphate reductase, small subunit, putative
  • NCLIV_052980 hypothetical protein
  • cgd6_690 ribonucleotide reductase small subunit, duplicated adjacent gene
  • Chro.60090 ribonucleotide reductase R2 subunit
  • CMU_027540 ribonucleotide-diphosphate reductase, small subunit, putative
  • TP01_0725 ribonucleotide-diphosphate reductase small subunit, putative
  • TA06715 ribonucleotide reductase R2 subunit or ribonucleoside-diphosphate reductase small chain, putative
  • BBOV_IV010610 ribonucleoside-diphosphate reductase small subunit, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_007060 ribonucleotide-diphosphate reductase, small subunit, putative
MAPTTPSPCLLNDIASSRLGATKEGAQSTAWLTSSEVLDSATDPKKLSAIVEKYRTPEQKLLSEQMKEKEKEEPLLMANP
HRWVILPIQHHAIWEMYKKQEASFWTAEEIDLAQDMTHWETLGENEKHFIKYVLAFFAASDGIVLENLAEKFLTEIQVPE
ARAFYGFQIAMENIHSETYSLLIDQYIRDEEEKLQLFDAVHNVKAVAVKAAWAAMWINNRNCFAERLVGFACVEGILFSG
SFCAIFWLKKRGLMPGLTFSNELISRDEGLHADFACLLYSQLKHKLPDKVVQDMVREAVTVERAFICEALPVDLIGMNNR
SMAQYIEFVADRLLTSLGVPKIFFATNPFDWMELISLQGKTNFFEKRVGEYQKAGVMADKDQQKFVLDADF

Gene-Specific Links for TGME49_007060

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins