ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_006690 (GAPM2b)

hypothetical protein, conserved, a gene from Toxoplasma gondii

Compiled localisation
inner membrane complex during extracellular tachyzoite

Who localised this protein by microscopy?

Bullen, H. E., Tonkin, C. J., O'Donnell, R. A., Tham, W. H., Papenfuss, A. T., Gould, S., Cowman, A. F., Crabb, B. S., Gilson, P. R.
A novel family of Apicomplexan glideosome-associated proteins with an inner membrane-anchoring role. (2009 Sep 11, J Biol Chem) PubMed / full text
   more detail about this publication

inner membrane complex during extracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_23364

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_052390 conserved Plasmodium protein, unknown function
  • PY06455 hypothetical protein
  • PVX_090215 hypothetical protein, conserved
  • PCHAS_052410 conserved Plasmodium protein, unknown function
  • PKH_052700 hypothetical protein, conserved in Apicomplexan species
  • NCLIV_044350 hypothetical protein, conserved
  • cgd6_2220 membrane-associated protein with 6 transmembrane domains possible apicomplexan conserved, duplicated adjacent gene
  • Chro.60260 multi-pass transmembrane protein
  • CMU_007650 hypothetical protein, conserved
  • TP01_0761 hypothetical protein, conserved
  • TA06890 hypothetical protein, conserved
  • BBOV_IV010960 conserved hypothetical multi-pas transmembrane protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_006690 hypothetical protein, conserved
MYSLGVEGDETLPVQQAFVSSASMEGYNRAPTGQNSTGPQGSGSFDFGEQLTKQLTRSINENLRPPANFDETPRGENHSP
FIYFFTSALLRTGSCLQAACLLLMCLFYVGFGGGGLFVFDEFAGPESVRMSDAFHLITAILMIGYLIGTFAIALFQLFVA
DSSKWTRGFRSGSKTISCAVTLDVVSGCLRVTQYIHAYFFSSVQWWAKYQRTQSDWGLYHFSSTLHAFALVTYGVGFFLM
ESYHDQGTYEEYAWSMLGLYTTAGLAELFMVYTGYGAFFTLLLVAALMVTVSWAFQFEPLLEKWSPDLHSRNLNENMLPF
DKVGNKSETSGPYTHQATMGTAAYGSGRCLTGEFRVEEMPSMQRSASVLGRQQTGGISESAAVGVPLSTFSTSMPGANDM
PTTYDYSTLQQQIATSGLEPGLVRSL

Gene-Specific Links for TGME49_006690

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins