ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_006610 (PDH E2, PDHE2)

biotin requiring domain-containing protein / 2-oxo acid dehydrogenases acyltransferase catalytic domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
apicoplast during intracellular tachyzoite

Who localised this protein by microscopy?

Fleige, T., Fischer, K., Ferguson, D. J., Gross, U., Bohne, W.
Carbohydrate metabolism in the Toxoplasma gondii apicoplast: localization of three glycolytic isoenzymes, the single pyruvate dehydrogenase complex, and a plastid phosphate translocator. (2007 Jun, Eukaryot Cell) PubMed / full text
   more detail about this publication

apicoplast during intracellular tachyzoite

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10806

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PBANKA_050500 dihydrolipoamide acyltransferase, putative
  • PY04573 putative dihydrolipoamide S-acetyltransferase
  • PVX_001900 dihydrolipoamide acetyltransferase, putative
  • PCHAS_050510 dihydrolipoamide acyltransferase, putative
  • PKH_060480 dihydrolipoamide acetyltransferase, putative
  • NCLIV_044290 Pyruvate dehydrogenase E2 component, related
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_006610 biotin requiring domain-containing protein / 2-oxo acid dehydrogenases acyltransferase catalytic domain-containing protein
MALPSPGILVHVSLFLAAVSSAFGLQLVPSSSPAPSASSTSFSGSSAPAFVAPAVSSGSGVHSTRPRFFASPSASSASSV
SSTNAGQRPLSAGSSLQTRERRCGSRLTSSLLCAAEGTVRRQETAVGSSLRGAVQEISMPALSSTMKEGKVVTWSKQVGD
RVEPGDVLMVVESDKADMDVEAFDSGFMAMHLVREGDAAPVGTTVALLAEKEEDISLIQAKGLSLISASSSPAADSTPAV
TDLLMPSLSPSLKTARMTVWRKKEGEKVNKGDVLFVVESDKADMDVEAPHDGVLAHIAVREGVTVDVGSTVGYLAPSAEV
ASAFKNALSDSAAPAAANPSTMPEGAQEIFMPALSSTMTSGKVSKWNKAVGDAVHVGDTLMVVESDKADMDVESFDEGYL
AAITVAEGESAPVGQTVAIIVPSKDDIAKVQDALTAASTASSSSPAHAPLSSASSPSTPSSRLSSSDSVSVSSSQSGRPT
TGGDSRTAAFMKHGQALARWTSPSVDQDVKDQLPEGLTGNDLQQEWLQRIEATMPTTFAALQANPQMQKALLERLNLRVP
PPHTLRVSPAPPPYLKRAVSTYGAATAGVPDTRASGIDRTSRGPARDPSGQPLATFNAIELAKKNKLNLEEVKGTGTNRR
ITAADVRQHLHLPSDEATVVTSKRENEGKIESLGVPPPGSVPLDAMQKAVARNMEATMDVPVFRVSRGIYVDKLEAMVQE
LKQIVAEQNAAAIAAEGPDAPQQSTVTMSVLLAKAVALTLEKHPIMNAAYNPKDGGQIQYVPHPGAVNVAMAVSVDGGLL
TPVLRNVNTKSVFELSADWAVLVDKARKRRLTAEENSAGTFYISNLGMFGVSQFDAVLPKGVGTIMAVGGTESVPFFPKT
GTLDAPAGNPSVRRRMTVTITADHRHIYGSHAAAFLKDFASLLETRPSALLI

Gene-Specific Links for TGME49_006610

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins