ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_006590 ()

CAM kinase, CDPK family, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10071

Localised Genes in this Group
Other Apicomplexan Genes in this Group
  • PF13_0211 calcium dependent protein kinase 5
  • PFC0420w (CDPK3) calcium dependent protein kinase 3
  • PFF0520w (CDPK2) calcium-dependent protein kinase
  • PBANKA_031420 calcium dependent protein kinase 1
  • PBANKA_040820 calcium dependent protein kinase 3
  • PBANKA_061520 (CDPK4) calcium dependent protein kinase 4
  • PBANKA_135150 calcium dependent protein kinase 5
  • PY02109 Plasmodium falciparum CDPK2 protein
  • PY03298 calmodulin-domain protein kinase
  • PY06394 calcium-dependent protein kinase-3
  • PY06527 calcium-dept. protein kinase
  • PVX_000555 calcium-dependent protein kinase 4, putative
  • PVX_002665 calcium-dependent protein kinase 1, putative
  • PVX_082820 calcium-dependent protein kinase, putative
  • PVX_119610 calcium-dependent protein kinase 3, putative
  • PCHAS_031630 calcium dependent protein kinase 1, putative
  • PCHAS_040910 calcium dependent protein kinase 3, putative
  • PCHAS_061690 calcium dependent protein kinase 4, putative
  • PCHAS_135610 calcium dependent protein kinase 5, putative
  • PKH_030080 calmodulin-domain protein kinase, putative
  • PKH_040260 protein kinase, putative
  • PKH_083010 calcium-dependent protein kinase 3, putative
  • PKH_121600 calcium-dependent protein kinase, putative
  • TGME49_006590 CAM kinase, CDPK family
  • TGME49_024950 CAM kinase, CDPK family TgTOXPK2
  • TGME49_042400 CAM kinase, CDPK family
  • NCLIV_011980 Calmodulin-like domain protein kinase isoenzyme gamma, related
  • NCLIV_017560 Calcium-dependent protein kinase 2, related
  • NCLIV_044270 hypothetical protein
  • NCLIV_047750 hypothetical protein
  • NCLIV_070280 hypothetical protein
  • cgd2_1060 calcium/calmodulin dependent protein kinase with a kinas domain and 4 calmodulin-like EF hands
  • cgd2_1300 calcium/calmodulin dependent protein kinase with a kinase domain and 4 calmodulin like EF hands
  • cgd3_920 calmodulin-domain protein kinase 1, putative
  • cgd5_820 calcium/calmodulin dependent protein kinase with a kinase domain and 4 calmodulin like EF hands
  • Chro.20118 CDPK2
  • Chro.20142 calcium-dependent protein kinase
  • Chro.30121 hypothetical protein
  • Chro.50305 calmodulin-domain protein kinase 1
  • CMU_009030 protein kinase domain-containing protein
  • CMU_009310 calcium-dependent protein kinase, putative
  • CMU_041080 calcium-dependent protein kinase, putative
  • CMU_042610 calcium-dependent protein kinase, putative
  • TP01_1073 calmodulin-domain protein kinase, putative
  • TP02_0399 calcium-dependent protein kinase, putative
  • TA12965 calcium-dependent protein kinase, putative
  • TA16180 calmodulin-like domain protein kinase, putative
  • TA16570 calmodulin-domain protein kinase, putative
  • BBOV_III005470 protein kinase domain containing protein
  • BBOV_IV003210 calcium-dependent protein kinase 4
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_006590 CAM kinase, CDPK family
MPEQSEVMGGRISRQRGGAQSQAPDPRHPNSSSTSGVARLGQSASPADRKVSSRHPHVAGQPHMSSRLQAPTPSQRGTSP
ASSEAGDQRSSSSGRTSAGRSRGAGLFSSTSTQKSKPSQSAKSTSATATLSPQPYTPTPESHRGGTGASPVTGRSPASGI
GKRCVPSPGAGAAAARDEAHSRHVIRHPSDSRQVAEAPISRDKEGGIDRSKFILENTGALTDFYEIDTATLGQGTYGSVS
KARKKDTGQMRAVKTISKSQVKNLERFRQEIAIMKELDHPNVIKLFETFEDHRNIYLVMELCTGGELFDRIISEGRLTEK
QAAVLMKQMFSAVHYLHSNNIMHRDLKPENFLFLDSARDSPLKIIDFGLSCRFKKGEFVSTKAGTPYYVAPQVLQGKYDF
RCDAWSLGVILYILLCGYPPFYGETDAEVLAKVKTGVFSFSGPEWKRVSEEARELIRHLININPQERYTAEQALQHPWVT
TLARNSQNVALPTTLMSNLKAFRAQNKLKKAALTVIAQHMSEKEIDHLRQIFMTLDVDNSGTLSVQEVREGLKRLGWTEI
PADLQAIIEEVDSDKSGHIDYTEFIAATMDKKLYMKEDVCWAAFRVFDLDGNGKISQDELKKVLGMPDVETAVGRATIDA
LLTEVDLNGDGEASGTSSVKSEAQRAPLRSYTAIDSQVIDFDEFMYMMRKKDPTEKRFDMSTRKTVNAAAVASPETRRAV
VQRPTLGSGPPHACDSPSPRVSERGTPTETHKLESAGAAPS

Gene-Specific Links for TGME49_006590

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins