ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_006580 (FRM2)

hypothetical protein, conserved, a gene from Toxoplasma gondii

Compiled localisation
inner membrane complex during extracellular tachyzoite and intracellular tachyzoite

Who localised this protein by microscopy?

Daher, W., Plattner, F., Carlier, M. F., Soldati-Favre, D.
Concerted action of two formins in gliding motility and host cell invasion by Toxoplasma gondii. (2010, PLoS Pathog) PubMed / full text
   more detail about this publication

inner membrane complex during extracellular tachyzoite and intracellular tachyzoite
  • "Upon aerolysin treatment, TgFRM1 remained associated with the PM, whereas TgFRM2 stayed preferentially connected to the IMC"
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: RH HXGPRT-
  • Gene model mapping comments: Blast from TGSYPGASDKSQQTFS taken from figure 1
  • Localisation record: IMC during intracellular tachyzoite and extracellular tachyzoite
  • Other genes localised in this publication: formin homology 2 domain-containing protein, SRS29B (= SAG1, P30), hypothetical protein, hypothetical protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_56449

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_006580 hypothetical protein, conserved
MLTKEARSFSQTRSAPIRPASCFSRFASLTKRTPRSATSSQSSTARAPPACRRSRRRQVSPCPSFESVFAPLVQGAGQPF
SGCIRSRLLGTSDIALSEALCRQSAPDSMPSLTPSNHSSPSIDRRAASFCPSPSFFTRSPPAAPAATNGSEGEDDPFCLP
SPDTEADWEAKRFLPSFSDIQRVFADPPPRRARSSRSSQRSGSVLSGAGSDGDERSSCSSSPSPLPATACWRGSDASLSD
REGQAEAASPRYWRQTVEKAGDMPNAKRVHPVRSRVPDFTTQAALNHGPSGSHSDSAEVCRARPAQWPNSPSAVPPFHPY
RAGLPAVDSSPSGARYEKTELMRRSVERGLPHTSTCGDVSAPVDCWAAERASSPPVSAVGASPATSLTPHSSVSPANADP
DRPSNQSPLPKSPPCQPGDVDPVSVHGGLRRTTSCRPTPASVSPYAAPSTVAFSAPQCCFGDEEPGGRSQVEVPTSVSVS
SGPSNVESRWSNSLRFNPRTGKIEAPPEDGEASRHRSKGAISPSLTPDGALPSAETSGSLDGSQAFPGRSSGAGPLRKLE
NGLGPLGGKVTFPPRQSTLYALHAPQPHSPPAVTSPGNSKMRLSSLETGRPHPQWQLPGAPMGGSSSGPKVRPGRTGRED
ADLHSSTTPLCVSPQPVLAQTSARVAQAVAAPVEEETGRLDGSSGIRSGVASGGPATQGGASVLAASRATCLANDNEVRG
GYETRRRDHSSHSPDASIPIPSVAWRGPGVLYEATDETLAEAEELLARNEARRSIARDWPPRGHSSRVNEAMTNSVTKAA
RLPGLETPAQTDASSDRRTDAVQVLRLSPGIGDSSPKAGVAAEILPPTQGSMKALATRGLGIGSPRYGLQAVSPPPPACG
PVPPSPLVQTCLVAERLLAMRTPWRLPTTSILKRNNIMDIVLYLATLQNLFRGPGPRRDELITRVKRRKRMSSLLSQLRE
ECSSRDASASLVGPSGSLFLQEMRDGVEASGSLGDTGNRETRAKTEAEGDKGTVTKPGEIDALTTLLDQEDIETTRTELV
RLQQRQFELVDLPLLSDSPYLLPSQQQQLVRRFLQMTPSPASGCSGLVEFNILYAYIRRKRGGSFVDVPTRKSKDASSLD
NSFFQDCDEDSRPLGASMQFMLSQLDDTPQHSRTYSHAGFFGPSWSSEDSGRAGSRAPAGSNRRTSSSSSSILSDDVMGG
FRLGSTMNPMEVKAALQLVRRAVQVADMAAGDKVVPEGSDRPDGAHGDVSWDQSVKTVSEATAGLMNLLEEETQSFHTAW
TGGEKNSSSRHEDGNSLGLADVLSVLYPSPPVFVIWDIVPAVAACSSHAGAPLGTQSAHRGTSLSGGPTTSSTDALSEGP
SCGPSHSRSGSAGSGSVSNPSVAFSNSGGVTARALRRRTEAPGGPGAREGSGALAASPRGEGGLHHSFGQGDAVSLSAPS
AAPTGFEDFYRLFRDQVLRYQTTEVGAPTLQLLVHFCSSVAFWLQLDRHQHFAVINIDPGCGFQGLLLLACAALVRSKWT
AAEVLQMLRRSSIAAQDGGQLERRLRGGAGCLTQQNGDASCRAAPGRQGSGSGSIGGLTSRKLGDKGRSGRAKKKTWGVI
CWQDAEEWPPSCRRYLHYFDRLVKRGGVEFTVPPSSADAEESGSKSVSPPSPLSLFGFQSVGETSPFPSRTPSPTNCGRE
TPGHKKFGVPSTPYRLKNIIMENFTPPAELVCVEVYEVSLCFGCRCRSASPHATVGTETRQPFDARGVEGSTSQRDSLER
KSRGIENSPAESCASPGAPSLSSGGSTTASTSVSVQKEGESSGGTFLSPRLKLPKNLFKKRSGSPGGNDGLAKGQEKGEG
RASAQGGSSSCLASSAGTVTMHSSLYAHPYIKALRQQELLCSRKTGASAGLPDRVPLLLEPAGPLGHLVPCCVVASAPPV
PVPGVEARRSFEPPDQDATRKTASGDGCEGSSTSGSVNASVPHSPTVLSQSRDHLMRRSGSRRTPAAGAEEELRKGTLCC
PMCCVGRSVGRKSSGPSFQGTRLGTSGPAGSSRGQDEEIRDPQADDSSRLPGLPLGEVVKEQFILRACVNNYQLMAADTM
EGGQTSLVFDFSHNREGDDQYLVLSGDLLFAFRQLAATPKHSASPEDADAPPGKEGGKGQQEREKVARRWSGGALKTDQR
GSKKIEWGTGQQVFATFSFHTGFMVQGTTDVQQLTKEDLDTYDSSHRDLIPDGLRVSLIFEPVRPSLFETGPAVRRPSRT
LSPSPPVSSLPASLSPGTPGFPAASGVDCAVGERSATSPEATATTPARADSVFAASTCDEGRTASPRSSSPSLRAGALSD
ARSDDGKKGADEQETGDRREKNEPGRTKRLEEESDQRGRYGGGTGLGALASWLGFPGSGTSSRASAGDTSEQRLGRADGD
LCGPISPCNKMTDEQRRLLRMMHDQQEKHKGQEAEKQRAAQVSRGDAEWNRWKDYILWRAQQWVGQPKPDRREFWRRHIG
VVDEVQLWRLSNLTGCGRDNCLVALKVCCNDVADALMFLSLYFASTTCPTLVHLFPSPLPLSLPDRDFLLRQAAYPASTD
VDVKASRTLSNASPHAAFSEASSSALPGVTAIQDADAKEGTLMPLGPTAAPSVGSRGPSVSSGQTATPGEPQPTTVAIAS
PHLRVSEGQGSVSKPVARSGFFSSEYPQPASGSLPSGTGSCHGRETGERGAGEDTRESAFSGDPVHDPSGDAGAARCFPG
RVGEQGVEASAGIYRTVSTSSILSTASASGFGTAGASSAYMRSRVASGVDPSLGFGIEDACGSSGPNSPTAVMSEGGSLE
PDRTLGSFGGWRRQRRMAPVPQRPGQLKPRQTPACSSSTAQPPRGPLAGASLPTHGLSLTGAVPLRRAHSVGGPSEASHL
VSASTHQGLRAGLAPPAIFEELPWGSFAQGSGERSLAVPRGHQNVFPTCGTLAAVAEGRAMQPGTLGACAMGTGAPGFVT
GYACMEEESSKASGSEPGFSGAQVVAPGAASQPGGTGGGAVVLAETTDRENKEAESPAVVLVGASNEGKELYTVRLPSGR
LVRFSIDQRKATDGQDTVVHASDVVPAPTGDTGSRAPSHDEGATAGSVGPAGDALTRGHSRVCRANASILSGGETSARGD
NTNASGKLESAVSTGPVSSCFASSGGEEAAVPGCRIGVQRAQIGSEEGVGKCEGVIRSGVEAQVPAGALSTVSVSAAGGN
GFPAGDSETRPVHKVVVPSVPGSSVPTSGMLVPGATEGDTKEGGETATGAGTQGSTVFLGTPPQVNMLGQGSGGPGGSPP
VGSALAGTPGVQGSVGGSSSNVSASGASPAVLSVNAGSGDSICRHSVDLGKVPAPQPPTASGDSPSPTGSYPGASDKSQQ
TFSAGAPSSGTNARTESTPAGAGETGASGEAKAPAAPKKKAMPPPPPPGKTPGDASKAPGGPPGKGKAPPLPKGKKAPQL
GKAPKAGGPPKKADAVDPMTLPLRRKIHWKTLGKEQIEGTVFKELEGDPAIPDMFDPEAISRLFSATLTVKSDEAAVKAA
PKKAEEKKHTILDNKRAQNVAIVLARLPLSLDAIAQKMLHLDTEGLTVDILQKVEQVAPTPEELVKFREYEELKKTENTG
DLRDVEKKMTALIPVTRLSSRVRVMQTALQWEKVVEEIEKQLALLCKAADEAHNSRKFRSLLQAVLQWGNYVNHGVKKAP
KGQEVSSESEARKAETTSPTEGDRRENRQTLQQLPPILLVKELPTKGFKLASLEKLMEFRTTVDKSICSLHFIISNLIVS
LPELDILDLASDMPSLEAAARLSDESIDAPVSYLRNEAAFLLSQIHAIKQVLAAKDATATDPSGAPRPSGSKPQTDEALH
AELTRLQKLHGEMVLTLERLRESYLNCKAVIGEVGRFYGEDGPKKPSAGKHKLKGQAVSVDAGGSATAGGVIAEWEFGLL
DQSPFELLFSILSTCRQGLRDVQANPRKYAILLVGRFASEEEKWKLLKFHIDNSLANRKRVTGCRGSDAEQVAGRPQDAD
KAGSSVVSSPRTTPRGSIASRGGKKLIVGRHGPEAGGTPQIPRGPPKSDNGSFTETQRLGRGLSEGSEDALSSPRSAERN
GSARGRLPSGTNDGAGTGVMRSWSQAGSKTASMGARFKTSSSEAVHAGDGIRSKTRRSSVSPPSKEESSSRRVSVATSHE
GDTDKPETLPGPRNWCFRSSKSCADLSVPHCGMKAGKRPMPPTGSHTREGKAIPGHIAELQALLQQRASKFAAGISVTSA
SGVQSPSGGTSEASLRREAADRLPPGGNRTPPTVRGTIESASNADNPSSLQTMSTPRPVSLGGAQPAERDVQANGENERL
RFDSREELRSEDSKSKVGDEDGQATSSPGESNPLAVNSSAVMELHSRSSATPCSSPRAARSGTAAAVGSEPKTPRLFSYS
ATAMNPSLSPLDALQPAFSDMALAASINKALFADDMDIVSPRSDADTPAPTTTHTLFSPCGLSLFPSEREGDCETGSFDS
LAPAVSAPHHFPSSRSRPATPFPVEESEHLANAGSHQGPGALTGTTAKQHPAHKGNSHAVRAGAVVFVPLDDSDPSAIVG
MNFQSTPGIGNELLSEAGDNHPTAAKGEESASKLRPDEDTQRGQSKQASLVNQDAGQHAMSGRQETGAVATESREAASKE
NGDGTKVKIRSTADAVSLLRVKVVPSTPVFCWEGGDVVAHPAGPRAPPCHRRPIICRPRRPPPPVVAKHPVGATGPKAPA
TATAPHTSPVRPPPATNRGL

Gene-Specific Links for TGME49_006580

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins