ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_006510 (TLN4)

peptidase M16 domain containing protein, a gene from Toxoplasma gondii

Compiled localisation
sub-apical
microneme during extracellular tachyzoite and intracellular tachyzoite

Who localised this protein by microscopy?

Laliberte, J., Carruthers, V. B.
Toxoplasma gondii toxolysin 4 is an extensively processed putative metalloproteinase secreted from micronemes. (2011 May, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

microneme during extracellular tachyzoite and intracellular tachyzoite
  • "T. gondii tachyzoites store TLN4 in the micronemes and secrete it in response to elevated calcium, suggesting a possible role in cell invasion."
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: blast from HQ848740
  • Localisation record: microneme during intracellular tachyzoite and extracellular tachyzoite
  • Other genes localised in this publication: microneme protein 2

Orthology

OrthoMCL

Part of OrthoMCL group OG4_39650

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_006510 peptidase M16 domain containing protein
MRRPCLFRSTFLLLLALLPLFSLLSESISPSSRSLPSHQTRALHADLDAARKPASFLSRSEPALSLSSSRETEEDPGRAA
NASARLPELEAALQEELQAAAVREIASGFSASSTRTLSSSVSSPSHAASVAEAETRPDSSSDPVNDGDSTSGGETPDPLP
TLAEVRAALASTVAQSRTFPRRLAAKNGEQVEDGDEELAERKRVRKPPRDTSAYSVFSVPALKLEGVAIADQEEAVGSFA
VSVGCGFFHDPPAIPGVAHQLEHLIFLGAEGEEAATSWDEFVSQRGGTHNAHTTAELTTFFVAAPTDTLPELLDRLLLHL
FHPLLAAEQFASEVMAVQFEHEKNQPDVARVLLELAMAVTPSLASPASSATQDEVPTSFYRPEVARKFGTGDFDTLCKTP
LEQGLDVLKALREFHGKCYKPENMTIAVRMGRRSVPIIVEGAVDASGQSLRIPAEVEAAAEREAEKRSVYTPKEIGEMVV
RILSKYVQANSPETEAHADKTKTPHNKGNSFSASSSSDLTPQRTPSDASSSASPSVSSAPASSQAKRRNEVLKTVRLHAG
ERQKEASQVASLLEAAVGEDAYRSRPNATAEDSSPTDGESDASGKLYRVFRQHGWGKRLLVVWERRTNWTVRGYDEVFQP
TALLEYLLEYPGEAALLNRLKAQGLIADAEYVDYTTSQKAFVALLFELTDEGEEKFEDVVSATLAYAEQLRTSVTETYIL
DFFDEFARVANRSWTYKDPEDAVSAVIAAAEKLAVLPQRPDMVIAGGEFVSLPGDRTLLVDVLKEELESFGRARASAIVV
LPEDTARGSAEVVHAFRPYGVQFSVSALPSLAQAEKVGERISRTDAAEKMELLHAELASEDLISHSMIESSAFPLPPVLA
CNVAATVALTPRRVPEICQSLSPVQFPIKGGRSDSELRESSELPLGPRSESLEDAEVEEERKKLEASGPPCVLVTEESFS
VFWKNAEPFNKPIVRGYFKLRVSAEDATAQNTLYGKIFATLAGERARTALASFQGCGVDLLMSFTNGALVLEIQAFSELF
APVLARLIEVLKESQDNVKQSDFNKIFNTLKVQLSDFSTVTPFELALDVALSVVRRNRFSQLDLRSAVTDASSQFEDFKV
FLEKVLTKNALDVFIMGDIDYEEARKLAEDFRAALSKQPLPFSESAGSEILNLADDIEIRFSNPIPEDATNAYVSLYVTH
PPPDMMEMVVYSLIGEVISSPFFDTIRTHWMDGYVAAAAVREVPPAMTLATIVQGSQRKPDELERHVCAFLAEMEENIGS
SMTTEAFLERLRWLSSSKFHRSATSFSDYFGEVTSQIASRNFCFIREQLARLATEKFLSCPAILKSYMNSLVDRANRKRI
TVKIEGNSSSSETASHQREIRAPSSTLPNRCGLPGLSPSASPSAEVRQAPSLSTQTSALRPRPLSEKRETTQSSEPEAPE
TSSQDGQRSVKANSPKPLNAAGSVGTAGKVEGKSRKVASRVDTPGNERRTYASLFGTQNVLRSSRIQSDFSSPIFSLGDD
ADALSLIQVEARVSTSNSKPKAVLGARRGDGQSPTVASPSGAAPKRPAPPAGPRDKSGEASETTGTEGMEVTEIASDVEG
QAEEGDVPIEFLPLARQITPHILERCAADQNAAGAKRIVVDNFFTDPVEARRSILENLEAKLSSTSSLFSLSPSSHPSPP
LWLAYSRSESCSIRTSTISRAEEVCGAWRESAPEAVLIVSPEQPPAGMPSLPPTLGDAEPPAAAVPLSPSGAETGVPLVP
ESPGSPAAAGRQAATKAPTESEASAATEGDHPRVGTSAEARTRQLPTAEQQTLEQRKALLEARLRRLEMQTIAQRAQLLK
QRLDAMKQYGTRPTTIFNTWLGPHKRGFLQSVGGGTGASSGAFPVSAVSGRSSTATRTQAASDLHGSRRLPSALHQAADP
LAFKRTLETLKWREQGLLQRQAELRTQLRKVNAFGSTAGDSTAPNLGLAEDKNLRLVENVTVASGASLGSRDQTAIAHQT
DVLPPPRASIPTVPTLTPAPSPVAFAALPQIHQQLPGVDVGAEIPRPVTPVSTDISASASAFVPGSVQASLSQSPAASVK
GAGAPPLPLAHQPFASLPPAPQLPQEPRVQEANVGSPSPPTVVPGVPTVGATAPTVGEGATTLGAGAPAVASPAPTVGAA
PQAVTYTAPTMGAGAPTVASLAPTVGAAPQAVTYTAPTTGAGAPAVASLAPTVGAAPQAVTYTAPTIGAGAPAVASPAPT
VGAAPQAVTYTAPTIGAGAPAVASLAPTVGAAPQAVTYTAPTIGAGAPAVASPAPTVGAAPQAVTYTAPTIGAGAPAVAS
LAPAVGAAPQAVTYTAPTIGAGAPAVASPAPTVGAAPQAVTYTAPTMGAGAPAAVASLARGPSFDYQAGVVSRAVGGASQ
PQAEQAASYVSDPASVARVSSASILPHAAVPVVHA

Gene-Specific Links for TGME49_006510

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins