ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_006430 (Formin1, FRM1)

formin homology 2 domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
apical conoid and inner membrane complex during extracellular tachyzoite
during not trophozoite
moving junction during tachyzoite invasion
not exclusively apical plasma membrane and parasite plasma membrane during extracellular tachyzoite and intracellular tachyzoite

Who localised this protein by microscopy?

Daher, W., Plattner, F., Carlier, M. F., Soldati-Favre, D.
Concerted action of two formins in gliding motility and host cell invasion by Toxoplasma gondii. (2010, PLoS Pathog) PubMed / full text
   more detail about this publication

parasite plasma membrane and not exclusively apical plasma membrane during extracellular tachyzoite and intracellular tachyzoite
  • "Upon aerolysin treatment, TgFRM1 remained associated with the PM, whereas TgFRM2 stayed preferentially connected to the IMC"
  • Microscopy type: fixed light
  • Microscopy method: antibody
  • Strain: RH HXGPRT-
  • Gene model mapping comments: inferred from another publication
  • Localisation record: PM and not selectively apical PM during intracellular tachyzoite and extracellular tachyzoite
  • Other genes localised in this publication: hypothetical protein, conserved, SRS29B (= SAG1, P30), hypothetical protein, hypothetical protein

Baum, J., Tonkin, C. J., Paul, A. S., Rug, M., Smith, B. J., Gould, S. B., Richard, D., Pollard, T. D., Cowman, A. F.
A malaria parasite formin regulates actin polymerization and localizes to the parasite-erythrocyte moving junction during invasion. (2008 Mar 13, Cell Host Microbe) PubMed / full text
   more detail about this publication

apical conoid and inner membrane complex during extracellular tachyzoite, during not trophozoite, moving junction during tachyzoite invasion
  • "The Toxoplasma gondii Formin 1 Ortholog Localizes to the Apical Conoid and Pellicle of Free Tachyzoites"
  • Microscopy type: Light, EM
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: annotation matches, 18329618 says “It is worth noting that the same study found the formin 1, but not formin 2, ortholog present in conoid-enriched fractions of tachyzoites”
  • Localisation record: apical conoid and pellicle during free tachyzoite, not during trophozoite
  • Other genes localised in this publication: formin 1, putative, formin 2, putative, rhoptry neck protein 4
  • "Figure 5. TgFormin1 Localizes to the Moving Junction during Tachyzoite Invasion of Host Cells"
  • Microscopy type: Light
  • Microscopy method: antibody
  • Strain: RH
  • Gene model mapping comments: inferred from another publication
  • Localisation record: moving junction during tachyzoite invasion
  • Other genes localised in this publication: formin 1, putative, formin 2, putative, rhoptry neck protein 4

Orthology

OrthoMCL

Part of OrthoMCL group OG4_20714

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_006430 formin homology 2 domain-containing protein
MPPSVNDDRNAVLNALPSRTSFSAPLCSATSCSLPERPVFAKLTGGMPFSRTTARIECASPACHESLSLHRVAESQVKAQ
AAASGPLSNSSFLIFLNSIPTEPPRCFLPPRRVASLSAEADTPKGSFYVFSESSRSESSHSEGCVESRLSGHTAARTRCR
RSRTTASATDSRRDDLFSFDLPQECGSAPRLPLPLPSRSCPASPCHSLLPPLSNKLTPPCRESQSEGTDHGSSSARCCQP
RPAYPPRITDALPTGQIYSRSPSRVRERTLRSEPAAPVNYSDTQKRCPAPLFQSIPVHSMPPPPPPPKGKKGPLPKKASN
SPLPPKGKSTPDEGAKKTPPPPPAAKAGVPEGKAEMPSEKAEVPQKKAGVPSEKADVPQKKAGVPKEKAGMPSEKAEVPQ
KKAGLPKEKAGIPPEKAGVPQEKTGLPKEKAGIPQEKAGISKGESGSPEGKTGPLPGKAGPPKGKLPPGKAPPAEGSGPP
AKSDLKASPAGAPPSSLPSKKAVASAGKPLGGKTPPAPSVAPNPPLGSSGPQESGSSTYYRDTLRAAAGTAGGIECSAGE
GSGETVPPPNEAYAAKAAMMVESLKLADYTNVPAAHAHGTEPPALPFAPGADRNPAILTRALKKEMELRRGQPTQTPEER
RLMLAGTFSLHQARLGFKLSPEHQRVAEALMLLRRLEDFRGSVQAGEVQRIRYLLRVGATEAFSQQRYSDAMLQALHSYL
LAKSYYTAYQSAPLEGEMVPELLLLVKCCGLAGCPDRGQEYLKELRYIVENTLIAEAGGSAAGNRGSLVGPIMRVEKHVL
ASVVSSLAELCSLYNQPDDARLFYEKYVILTKDVYGADSLAVSDALNTVALYFFRTRQYGQALPLVEQVLAIRKKHLGDF
DAAEPHARVADCYANIGLLHRLLGHPTEAFPCVLIALDMRMRIYQTRETSGVQDLVLALGCLQHQAGHFRAALEAYKEVW
TFRNNTLGVTHPDTVNVELLLRQLEKDLAAQMQEDKQRFVQRDKALPSASAFDLTTRASSQISVSRQSHRPGDFFYEEAD
GAASSDRGRRGSLDFADASATVRLLKPAAAATLEAYRQRHAACGWTQPLREKSHFHSVARVRALYGEEWRSLMVPSAAIL
PYVDVEVTGPDTLKLAECFQFQEALAVDRPTLPVVNVPQIERGEAVLEQGHPHMVLSPDAAELLSQWGVALPEVDEKGQV
INREAKLEKHGRLFLPLVDPSTNQPFLGFYGEPVMVPNPAVYHSVIAPAILAYARRQAALVDRAKNAVGPAQKQRSAMVQ
GAKQVARGVVMAKLGAKGKAGAKTPAQDAPKGLETKDAPATAAPAAKEGGAPETAENAPPKVEAAAAAPDKEESVEKKEE
ASPSLPRKVSELPAKKSLLRSKASQEIPKAPPLKDDSSAPESGSDSGASDRKRSPSLSTKKSFAKKTSAALPTPAPEGAT
ADGKPKSLLGSGAKKFDPSAYKAKVKAGPAPGKALSFRATPKHAAALPPSNHLREPATLSDPDAILERKQKSRTKAQTTA
ADSHELGRNDMLEREEEGDGGGEEGLAKRKKVVFQKNVEKGRKVSELQHEASRSADGRVGKNQQGPAAGRHGLKAKKLNA
ETERNSESEEKSSCGFAAPQSSCTRKREGSPETRCINVESVPQPQEGPDGSRDTTLASLSPPDSSSSLRCKKASSKLELS
VECSASRDEPSEAEDRREENRREERREKTRRDFKALLLKKQREHMSETLMRLQKETDREASESASECKIFLKMQRSLERK
DEVGLFFPRASGNQTTPPAFQRASWQAAALAGHLRSGDSLWTRGEETAEADIMGRGDESALLTRRVEEERKRVRERLLGC
DTRASHRETSLGADSGLFALDREAQRPAENREFPEPHCVSSSPRKAIDQVPDLNCRAALDPERKSFSPDSDRETSIALCR
RRVSPSGPVSSPDSRWRGDRRRNASSRPTLDWCLSQQGNATESSSPHRDTTSRAPDSPHVKAASKESNFLSMPFLAAAAP
PPPGLFSPWASPVNSDGNGDTEGTLWDEGIEAGGSSLTRRTRSSERSLEKRSVRQKAPSQVSEARGTLMSSLNAGLEAKK
TRADERRDIGTVFCLSDSRDTEVKPGEETLFQSAAGESWGVDRRYVEAEREAEQRRRRRTGGWGRHEGTANPGGRGRTGS
RGEASTWRRESTSSATEAEIRRERVEQSRPDSGRRRDTRERKRSVAQGAVNRVSRATGRTEGVAVLGQERRRCVDARRRN
EAEDREGEDLGEAELSVSCFDSDGDQEKDFRRETSSEEDNEEDGEEAELFSTNEVETDTLRSGRRKQHSVSSRSASPSPW
RVGADRTRMKTNSQASAALSGMRTSRFLQPPAFDSSASRSSSASPSRRRRLETLETLDLQKRTRKQRVRVGSRESREGNA
QRSPGNRRRDKKGQTEGRRGDWGRAYLERLVVGQETETDSEIATLDEELDRTELPRVVSPQTFHEAPNPFSDQDTETDCL
FSTPRLPVSNADPQASKTHSEADEYVVSFASQSSAARSSSCYPSRSPSCSALSLSFACSDSTVGAESATGRERTVHLLRP
TSSSVSSISPTSSDCGRLDSELDALPGLGKCTLFFSAPEAVHARPLASPSFRQRLFSRRDSGAERASCGDAFDSWSPTSA
GAGSRVVESCGSNVSSPSRGRLRSRVSLGGLKAAFSRHSENSSNERLCSPMHQETSRKGPLAVARRLSGVASRLVHSRSS
LQELGEAEDDSRKRSSEGDSQEIPRDSVGVTALTGDSETPNGWAGVGGLEVSAGEDSRELRECEEKERERTPLGGSLRRF
SFSSDLRKDPRRPRRTLSDATATCEGDGKMRRLVALLRRKNRRVKKEGEQESERERRDEGEQESERERRDEGEHEGEQES
ERERRDEREQGGEQESENEQEAEHESERERRDEREQGGEQESERERRDEREQGGEQESERERRDEREQGGEQESENEQEA
EQENEREQAVGEQGQEREGEGEQRSECEQGGSVINVWRQAEKEESSGKQLSKGEESREGEKGGVRAADNQASGATQGEEQ
EQSGSSRFSQLLEKWARMSGGATPKQRIEMISDKSEPGGRWRKDMGILKDSEEESLIGKEGISQRLTDADTGTEKTREAQ
REDAWVVTESARDRRRALGTTVSLEEVSLCAVGSSESHLEKLGSGGDENDCGRDASEETKQGHCCEDRRSLKREKEVSDW
GVQTSHEREKQVSARGVETPETKEELPASPLSGDSSSSPLAGSASNVFPARKRLFSSRRMLRLPIPSRKLRKADKPGSPS
DAQNSAVSPSPSFQLSRSAEAATGGPQNVDEREVAVLSGALEVQTEGWGVQTAPETPGNSTHWASPSFHSLFSRRFSLRD
RLRRRSSASSMTVLDMEENKSLDALSVDMPATEPQRPLASVSDSLVFSEGLSFSSCVDPVSDFGDDNEKDGVTQETRSSC
SEVPCAGARAGGRESPTSRRHSFVFRTTQQKYRTEGSADNRGRRSLKVLRRSSFSRAFRGLVKSPERQILRDRDREEGKA
QDTARRSESEREGEKDDEEKQTGKREGRKLRHLSASFLRIPRPGKHETNKESVCKRRGASLPPLPPEASSPHGASRLRAA
AASFSRLRRRSQSSVNRGKKEAIEIEKMEEETKAQNEIKHERKSELKQEEVDEMKQENVDEIKQERKGEVKQEEVDEMKQ
ENVDEIKQERKSELKQEEVDEMKQENVDEIKQERKSELKQEEVDEMKQENVDEIKQETPETVPLWEPSITSHLSDSCGED
VAIFAVEACVRAARTWQKEDETLGASVAAGRGEDEDECVDRGDALTGQDDNAEETSQRCSCSEDSPEGVAEREWMGGSSD
GAEIHLLPEADTSDEEDEGEEEEEREEEKEEEGEGEEGEEEEEEGEEEEEEEEEEEEGEEEDIHELGEKEYSSAEEETRI
GEAELRHGVAILNPFASCGAEAYGEERPKTGTTGSEADDDSWAASDWSVGASSSDEESERSWQEGPSSEEDCDETEAEKN
ADSEVEELYAEKLCRKKVHAENDVEECKTEVSKAEEGFQNSMACLAEVLRLTGVPYSESDLSVEIAELNRQSTLLMVTPD
TQRLSRELPKSIASPRTSAVPLDKQCDGKTNLTHLPKSAPFRKAMELTRVAYRSGKTPAACSVLRSSSSSNLASSVSSSR
SSSKLVSSSRLYATPREPRSEPREASGGFSVSPIACDSSPFAPPAAPLGASEGGRESLSCSDSSSVLVGDRPPRFSTQQL
HALPPKGPKGGPPKKGKATGWKPPPPLPPAAEDGTDVKEGPTVLKQGIFKKAEQAVKKEIPKKEEGSPKEAAKVVEKKVL
EKKASVSAAKGETETKVAVKSVAKPPPLKAAKSGEAKTAEPVKEEAKVEKAPKVKGDGFSRMKLPSGKPEEAPKKTPKMK
IMVGTTGQAKVVEKKDSMDELDAFTGPCYIPPHMDVPPVAPEVLAKITKLKPGVEKDPQLGELPVVILMDDNNTELARLP
WQVDISSFSLAQSSMSILVARRLGLLARRLDEDKKDEDTRDWLTGEGLKKFGLSMQKEKPTFGDTSLLLGMGLSALPQAL
AQKKPEAPKKEEAKPKPEAKKEAPKKGPPGGKGGKGPPGKGPPKGKGKGPKKKGEGGLKVGKKDEGKTKRFFWDPIFEDE
IPGTIFMKKPNMVLKLQDVEETFAKVVAKKKTESKKPKIIQLLPDSKRAYNMSIALSKFNNYSYQQLREAIIDLDPKILT
IEATETLLNFVPTGEENQVVKEYINSGGDLKLVDKPEQFVAAMLGVPLMKQRLEAHAFALNFREAYSDAYTPLENMADAC
DAIDDSQNLKIVLFAILELGNALNEGDPQRGGAAGFKPTTLAKLQEIRTTTKPVRTMLQYICDIIWEQQPTALNIYEDLK
ICDKAQRVDMQGIEGRISNLKAGLTKVKNTLEAAKKGNESTGVMGDRDPLRNIMDEFLIEAEPKIKQLDDFLVQVQNQFL
QTCHYSGYPDKDVKKIKPDELFKQVAGFARQVDAIRKQKQEIADRELKRKEAEAKRAGKGLKSTAVKKVGE

Gene-Specific Links for TGME49_006430

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins