ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_005560 ()

nascent polypeptide-associated complex alpha chain, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10736

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFF1050w nascent polypeptide associated complex alpha chain, putative
  • PBANKA_112070 nascent polypeptide associated complex alpha chain, putative
  • PY01462 Egd2p, putative
  • PVX_114205 nascent polypeptide associated complex alpha chain, putative
  • PCHAS_112020 nascent polypeptide associated complex alpha chain, putative
  • PKH_112770 nascent polypeptide associated complex, putative
  • TGME49_005560 nascent polypeptide-associated complex alpha chain, putative
  • NCLIV_020130 hypothetical protein
  • NCLIV_020140 hypothetical protein
  • cgd5_3450 nascent polypeptide associated complex alpha chain with an NAC domain
  • Chro.50027 hypothetical protein
  • CMU_015710 nascent polypeptide-associated complex, subunit alpha, putative
  • TA11185 nascent polypeptide associated complex (NAC), alpha chain, putative
  • BBOV_III009510 NAC domain containing protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_005560 nascent polypeptide-associated complex alpha chain, putative
MAGDPSEAQTRREETGSSSSSCSPSSSSSFTSSTSRQACRFSGCPPTSFSPPNYASCGAVGLPDFLEARASSASLMQQWL
SQAGGVASVSRRVSVHRSAVGGHINGLDIEEVIFCLLDALRADSGDHQKTFLLRLHAALKCSALRLPSDSRGGAESAGDR
GDTCGTRGGWESCEEDKAGAQAFRGRERGGDAFAEALQLRGSGLHSSCSPQVSLRSAAASTRLLALDSTDAVIETLYLFA
EKHLTLFLLAIRSFLEVRITLEEHQLAIFFVLLRALGLWIQQQTPSPLAGTHGDVVERRDRGERGEAGNIGERGEAENRG
ERGEAGNRGERGEPENRGEIGEVGDEWAEGDKGDLGAGGGELGRQGMARGEEGEERTAGEPSGREEEKVETPRLLGQEEA
GRKQFLQDEEEQVAPWENEWISFALREYPLLKPMDERKLCLGIAMNMIGAIHPKTVLYILAKELKKMRKAAAFPQTADLL
HLLCQLLPLFPSHLSLSEPSRRILLSLPSLICSSYSSTGPALRPLASSASPLPSVSASASASSAPPEDRLPPPTEEGAVS
PESLPDSAASPVPVAVRSRLRLAACSSLSTASACLALPCEQSLVAAALVGLAGQTQAALDALQASAAASLPFARDCLCCG
CTRRSQTRSQGPLGEAGRVREADADQGDEPGCCGSVKTLGKLPSCLALRRLSPAVWALGEEREENASFVAGVDCEAETRD
DEGEKEKQREDGETRVLVRDRGRNPVSAAVELWRSLQEILLPLLLLASDEADGDDEETEEATFASFRQALSASLHLLHVI
SHQNFFSPLSSSSPFPWVSARGVSRLAHFVEHVRTLLQLLLLHLLCAAQRRSLVHAVRRQPRILRRRETKKLDRTARGKK
RASRRGAAADPALAGDATEARRELSEIGETQEDNAKGSPKVWEGDTTFAQFVEFPALVQMALDEEVRVFIHRIEGESDDS
EEESQRSAGTGTESLPDPREVQSLFLLLLRCMALDTALSAFSKERGDGREEEKRREEEREEGETRKESDQEEEERGEASH
SGGETAAAGERLDAHPFARLLQRELYPILVTSTAVLSTFHQATLSPSSSSSASTSPFVSPFSASSSSPVSPSSAACASRP
VGRAPSLFAASPFAIAAEPLLLADFLNPLAAAPPADASAALAAVSANASLWSVLSSRLRRETPLSLAHRNSAAAQRPRPG
VLPSSFRSPHCPLSPAPASRCSSLSEISQTTREEDARESEEEKAAGEEGEDAGEEKSDLFACRGALERGEIAVAVLRSIC
VLARFQLTSVPLFATLLDLLRRGVTRRDVVGAWEKRREKEEEHAARVTLLVMASHVVAVLPVRPSLASLRVRQLKLSACG
CSPSLLLKRSRPQSCPERPSSSSSLSAVGLCSVSASQALPLRAPHARCAPQASEQSLSAARPLWSKFASRLAPVYLQQRG
VLAEDLLLVRQLFCVIAVYVLRGDAVRLPALASALLGLLQCLAENHYFSHMSLLEDISPEKANSTSNSLHASAFSLLVFG
NAGEDPDSARTWIPKNLPVNRFLSSSSSSASISAARESSFRRRQEEFNLAFLKSVCLLGAPWEALLTLEEGATSPAPSDP
SEAEESEDETGEEGEREEDDFTRELSSSSGLVQGSASRLPKPGAGQRNGCSPPPEVDEKDAQDTTPFSSFFSLGKASAIV
STRPQTREQTAGLPLDSSLPAIAITRPPSDAFTERAGRRASPPSSGDVRSASGSLAVPPRSRQEKESPSAVSLVRQAWCG
SPPVEVACLLLFALRLLALLPTDAGGGATAESDSFRDKAEELRIRDRATRLIERDLCKCVPGLLFPLLIEALQQPRLDRA
LPVVFRCLATMADVRACAELSELPARPHPPTERSTDAARGHAILPEEVASPPLSSPHRASPSHSAAWLELLSDAVFVKRQ
ADTLAWLLFYAGANPGRQTELSIGALQALKSLRPFLFRPPRASSPLCSSSSPLCSSSSPASLPSPVLSSGHSGTSNAVSS
SDSSRRLEEVAVSSRLETQANLHLDGLLAALAFARERHECAAQSSDCPLSSSLSSSSLSSCSSSSSSSSFSSSASSLCPS
RCLLSPLARSLSCLPWTAELASQLLLHVRACRFSLQMFEASLSPASLSPASLSPASLSPASRASAQPLDDFFLLHCLCSL
LAVAASLRSLAGQSCEKKDMSTFPFARQMSGLSASAKDTVREQAAAASFLGVLPLSLPRLDVLLLHLVAVCARETSDIHV
RSAFLRALLGAALDDPTALAGLASRVGAETGQRGDTAGTDDLEQQKASAGEAWDEPPAAGQRREEDEGGLPPPWTNLLDR
HKKAGNRDDEEKLSFARGRFFSETRRGVLTLHAVVDACLLLTQSLPAVAHAFQSLPLSPSSSSSSFDLSSFDSSSSSSSS
SSSFAASRDRDLSTFLVDRAPEESTLASKSQKAPDRGKLWGDPRAVKRRWREFLRVARSAAADLRVALLTPDAARRTARW
LARGSGAPWLRSQLVLPAASEVVSLFTDLQTASADESSAAAKQAAAAKKAAAAKAAVASPKKVDDVAVAAFASGGAPSAN
EESSFTRSSSTDLRSSRDLRSSSRAAATGVGGLAFARFPGAASRSLSGRGPEPRGWRDSVSSAPLSGESARLLVVARTLG
VVASAEAAFADVWRHLVHTEAACRPKARLMSSFAFFGKSETQVKEEKLRALLLFCRGVCAANAPRTCFSLAQLLGAAQQA
DRLLQKAQGAGEREAGGRGGIQTRGKTAGRDHAGTFVSAWQGFAALWGAAAEGTVGSDGGVDELDRRGERRDGKRAASEA
GRREAAETEEENRHTGQATHADGGEEGKEPHKAEKPEEVQRVDGCEERPTSVARLMSQDKGSIWKRNAEEEERDKHRGKL
EEEREDAAGRAWRSWTPRSEALKANQTSLASPFSALLGESGEVDLAAAAQRLSAEIDAILSPLEMHQEKTASLRQKRNAL
LSTPKSTETHKRASRGLRSESRRENISGEGNGEKEDIDVSCESRRSTGAAVRGEDETEDGEEIRQSLSTEQEGTAAVAQA
TLLSFVRLVLPLYNISGSDDREVALALVALRAVAGAQGLRLVSEGRSLCSRHLRGTSDASGVHRGGGSEGGPSASLSDAS
PLSRSRQLANACMFPEYRPLDSGLSNGDAVGWTAFLLPETFVEAEDNDAAVWTERREEEERSAAKRQERELSGTEKGERV
RSGEEEESTWSDPGSDRVANPVGRGGEGEQDTQDKMREEERRDRSHHSSSCLSWASEWSPGDALRRRVPLLNAFTRFSEL
VLLALLPLVSEPRGATRAPLRLLAREVCAAQEVWRGWRRQRRPGILDPLLPLTSLLRQRGHVILRYRDASELLESFRPAL
LPALECMRAFLTLAFPSSSLAFDPLSSAAEEEREGKGFEDRGQETRVLFPVDGAVASVVLLHILQLLKVLVPTPVAEFLR
QWRAAHLPAFCVSPSPSASRFFGASALLPAPCEASSRSTFRSPLSLVSRRPLDAVAVGSERNDSAESLPDAVSSRHPSLE
SPSEIPRTPFAFPAGRSRRGKHKPGELARAHAVRASDFGKYGDERGKTAPEESRFVSFEQLCVADPSSSVDRAAGEVILA
LHTQRPEWTATAALFKSIHFRLTGSSSPFLRWKGLRLFLSLAAQAPMLALPEAFASSLFAEVEAVAGDCSCPTDTLLTHV
ANIPISSFLPPVSSSSSRASASPSPRPSSSSGVRLQNALGWLHCLLLTLPRLGDPFEDNRRLAFAVLRELLLRCTETARL
LRLLARDSFSPAETRQAQSSGPPGDSEILDSFQETGRSGLCSSASGRSRGVHGRPIPEDVLADKTSSVSSRFPAHKWRQD
DVQVAPAPFAGRLVLRQAPGDEEDSETHAVCEDILHFLLAAVHADKSLSSRLLSFFLLPLAEDDVGTSALFSLLYCLFFL
AQRRPISMLSPLASSSEREQKDAAREEGRSPRPREEGDRHRRGSAKISSEAENVFCLNEPRVSQEDTKEQGGKADRGNAE
DRRVEDASLFFSPLPLGVSPPARETPEERQARLLTAAIVELLNRRRKVLCGDLERRFRETEPQTETLASAMHTGSAQTQT
LEPRGSRGGAGVSREEEDVSTTSVKGSPHRSSRRRSAPQACPSSSCFSSSSSLPASFSSAWSASESRVDSELRTWCFASF
PTASSPTFPVFPEGLVQLAALRCVAEAARVSLSAVLSVLVENSRVRSSCRLASDAELGREGDVLSGDALGRENRKREKLD
REIAADVLTRPGQCCLASLLPVGRQQPSSGEASRRSAGKIRGCVHSLLANVLSESWELTKQLLRLLTAVLNNAPCTLSVT
AGALASRLGGDGDAAFPAEARGRRGADDFVPQLERDRAKVDTVLLNPSVHQATLLLLLLVSVRGSPEGGLEEQGGAGEKE
SSQRDERKREEAPARPPSSSASTSFSLTFACANSRGEKAVRRAVSRHFPLLLATALLRLGSSFSPSASPSSASDAPQTLF
VACTPAHADKQTRAEGSTAVSSERGFSPTRPRSGSGADAAAFEELLRDPETCASPRKTSREEANDAETRTTTETQETTNS
GREDRKSPDRRRSSREGREREGEDGGEEGSFRLTLVSQREAVDAAVALVHALVVAAQETELLVLLKKGNIFENMQKETTF
LHAVKDAMTCFLCLRPSAAGAVLAFVLPFVERSEKMQALVACELIAAVASSLFLSSGSAFLSLTSSPSGSAAERSGRLCE
CSAFDVCRLRQTGKGGFLDLLAFSSSPLLSPRPSSRACRVQLSGLSAFAKPSAPFSAMSAARPRKASPLSHGPPPSLLTL
ELDALLHALDRFSFLSDLVEETLQSGLSGQSEDASLQVAASRPWYFFGRAQEAAGDAQRCDALRAQTTALQRNLRRIFSW
KNLDVFAGNEELGTRLSPDCSVLTALKTLFSALAALTLLWANRLGRRRGDPRDPRGQERDSGSEPEGKAEEGKKDGEETD
GTKEGEEAETEREEREAERDEDSKEEKVEFLFGSEDLATDVVATLKTHTRLRCAVFHLLSNLFLFRDELLLADASSSSSL
STSSDGRLRSFSPGASGTAASSRERETRNANLSFAHLDELLVCATGHLVSEDADLVVAAASLLDRAVLPLLLVDSSHAPP
VCSPRSASSLPSCASPSVFPAFPSPRATREREESAAVAAGRQALRDCLVSLGVFRSASAEGVEGDRCRQERGDETGKAWR
GGRDVEEENLCSRSLGSSEETAFLSRERTHRPIPPLLRAQAVQQFVLKLLPLLLRSTSSRLPSPVQSPRPSSSSSSSASS
SPPSALSSGRRRGSGQGHFESAEQLCRRESVEFRRFGTSVEMGVQSSPPSGRKHRPRSAGVAAPPCFELHASPAWLSRLF
SLLLISRASFPPETWALRVEPESQLLDAQKTQAEKRVKRRLEKVLYGHPDAALAAAKAAAQLNAAKKRGEYFFEAQKLPA
GLASVFGGGPEDTAQGLEESAEKLFRKFTSYFQIVGDIGADREDDGAADARGASRGESSSGREHRGRAGRRRDEKEREDG
EGEEGEGDEELGESDAEEDPSSEDDSEREDGDDLAVSAELRRWRYMEEFLLDEGLPASRLLLGMHASTDVFCLQEAPPSV
SSLSPSLSRSIVKGASSSSEHSGRMQRERKSTATLEARCRESFHVARETQRLSQVTAHAAHVDMFLGSSSFALAVVRSIA
AVLDTVPEETRLRVKDFLRLEALCVATTRFSAAAKGSVRLSPGRSLKVETSFFPCKFSAAGATEFEKQSAFELPKRTSSV
PLTFLLQRDCTRSMWSLSWFVAHCSPPPPSNIEVAARTPQAPTAFFPREKQAARDFLFSPELPFFFGTSLQHLRLPFCRF
SGQELPTCSQARFRRVLRTLFSRMTAVEERKHLSASSVDSESDEECPKLEEVNQEEDAGTPEGRSKQSRNEKKARKAVLR
HGMKHMPGIVRVMIRKSKHILFVVPKPDVYKSLASDTYVIFGEAKIEDLNSQAHSAAAQRFTQAANAQFPANGAATAADS
KEAEGEVDETGVDPKDVDLVMSQVECSRARAVAALKANNNDIVEAIMDLSGN

Gene-Specific Links for TGME49_005560

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins