ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_005350 ()

fatty acid elongation protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10517

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFA0455c fatty acid elongation protein, GNS1/SUR4 family, putative
  • PFI0980w long chain fatty acid elongation enzyme, putative
  • PBANKA_020430 fatty acid elongation protein, GNS1/SUR4 family, putative
  • PBANKA_082090 long chain fatty acid elongation enzyme, putative
  • PY03060 unnamed protein product, putative
  • PY05248 30 kDa glycoprotein
  • PVX_081320 elongation of very long chain fatty acids protein 3, putative
  • PVX_099415 GNS1/SUR4 domain containing protein
  • PCHAS_020270 fatty acid elongation protein, GNS1/SUR4 family, putative
  • PCHAS_082120 long chain fatty acid elongation enzyme, putative
  • PKH_020420 integral membrane protein, GNS1/SUR4 family, putative
  • PKH_071720 fatty acid elongase, putative
  • TGME49_005350 fatty acid elongation protein, putative
  • TGME49_053880 GNS1/SUR4 family domain-containing protein
  • NCLIV_008210 GNS1/SUR4 family domain-containing protein, putative
  • NCLIV_020350 GNS1/SUR4 domain containing protein, related
  • cgd8_4630 7 pass integral membrane proteinwith FLHWFHH motif shared with fatty-acyl elongase
  • Chro.80534 fatty-acyl elongase
  • CMU_042000 GNS1/SUR4 family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_005350 fatty acid elongation protein, putative
MDIRETSSMELDRRPLGMPSTYPDKSVLSLSEAYPILNPLYSKIETEYNALPWLQWTVERYHFAPIAVTLYLLFCYFGTR
WMKNRPAYDLRRPLKYWNLFLAIFSFMGMIRVVPHLFEILRRWGFEVSICSPPVFTYGHGASGLWIFLFIYSKYFELLDT
LFIVLRKRPLNFLHWYHHATVLLYTWDGYCVEQPAGIYFVAMNYSVHAIMYFYYFLAAQLQRPLPWGIFVTIAQISQMFV
GMGVTCVSLYYSFAYPLVNKWTGWEFTDPMTHGQYISARNLVYGLLMYSTYLYLFAEYFFKRYVSKASHKKIQAEKAQ

Gene-Specific Links for TGME49_005350

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins