ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_005250 (ROP18)

Rhoptry kinase family protein ROP18, a gene from Toxoplasma gondii

Compiled localisation
cytoplasmic vesicle and parasitophorous vacuole during early intracellular tachyzoite
rhoptry during late intracellular tachyzoite

Who localised this protein by microscopy?

Taylor, S., Barragan, A., Su, C., Fux, B., Fentress, S. J., Tang, K., Beatty, W. L., Hajj, H. E., Jerome, M., Behnke, M. S., White, M., Wootton, J. C., Sibley, L. D.
A secreted serine-threonine kinase determines virulence in the eukaryotic pathogen Toxoplasma gondii. (2006 Dec 15, Science) PubMed / full text
   more detail about this publication

cytoplasmic vesicle and parasitophorous vacuole during early intracellular tachyzoite, rhoptry during late intracellular tachyzoite
  • "ROP18-I (green) was secreted into early PVs and into vesicles in the cytosol (arrows). In late PVs, ROP18-I accumulated in the rhoptries of mature daughter cells. Cryoimmuno–electron microscopy confirmed that ROP18 was found in rhoptries and released into the PV"
  • Microscopy type: Light, EM
  • Microscopy method: Ty tag
  • Strain: GT-1
  • Gene model mapping comments: Blast from EF092842.1
  • Localisation record: PV and cytosolic vesicles during early intracellular tachyzoite, rhoptries during late intracellular tachyzoite
  • Comment: Interesting virulence characterisitics
  • Other genes localised in this publication: rhoptry protein, putative

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>TGME49_005250 Rhoptry kinase family protein ROP18
MFSVQRPPLTRTVVRMGLATLLPKTACLAVLNVALVFLLFQVQDGTGITLDPSKLDSKPTSLDSQQHVADKRWPATVGHY
KYLAGATESTRDVSLLEERAQHRVNAQETNQRRTIFQRLLNLLRRRERDGEVSGSAADSSSRPRLSVRQRLAQLWRKAKS
FFTRGIPRYFSQGRNRLRSLRAQRRRSELFFEKADSGCVIGKRILAHMQEQIGQPQALGNSERLDRILTVAAWPPDVPER
FVSVTTGETRTLVRGAPLGSGGFATVYEATDVETNEELAVKVFMSEKEPTDETMRDLQRESFCYRNFSLAKTAKDAQERC
RFMVPSDVVMLEGQPASTEVVIGLTTRWVPNYFLLMMRAETDMSKVISWVFGDASVNNSELGLVVRMYLSSQAIRLVANV
QAQGIVHTDIKPANFLLLKDGRLFLGDFGTYRINNSVGPAIGTPGYEPPERPFQTTDITYTFTTDAWQLGITLYCIWCKE
RPTPADGIWDYLHFADCPSTPELVQDLIRNLLNREPQKRMLPLQALETAAFNEMDSVVKRAAQNFEQQEHLHTE

Gene-Specific Links for TGME49_005250

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins