ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_005240 ()

cleft lip and palate associated transmembrane protein 1, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_10902

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0384 cleft lip and palate associated transmembrane protein-related
  • PBANKA_091140 cleft lip and palate associated transmembrane protein related
  • PY01217 strong similarity to unknown protein-related
  • PVX_092480 hypothetical protein, conserved
  • PCHAS_071270 cleft lip and palate associated transmembrane protein related
  • PKH_093510 transmembrane protein, putative
  • TGME49_005240 cleft lip and palate associated transmembrane protein 1, putative
  • NCLIV_020430 hypothetical protein
  • cgd7_3290 cleft lip and palate family of eukaryotic membrane proteins (potential transporters) with 9 transmembrane domains
  • Chro.70367 strong similar to -related
  • CMU_023300 clptm1 family protein
  • TP01_1151 hypothetical protein
  • TA16615 hypothetical protein, conserved
  • BBOV_IV011540 transmembrane CLPTM1 family protein
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_005240 cleft lip and palate associated transmembrane protein 1, putative
MKMALGKRTDVSFSPADADESEAGGPASFASPCSRSLCRVSDIAIRPADAAYDPVLFHSDFWLLERNFVPLNETLAGLPL
NLTLSFGIGSVHGWLVQEQLGAAFEQQQRMGLQSNREAMMFKRIIIETNPFMLAFSTAFILLHSVFSFFAFKNDMQFWYK
NDSMEGLSALSLIFNFVCEIIIGLYLFDSGETSWLILFEICLGILLSAWKVTKAVKLSLRPAFPYIHVDFMKSYTESHTQ
EFDSVAIRWMSIILAPCVAGYAVYALLNNKYRSWFSYIISVLAGSVYTFGFITMTPQLYINYRLKSVDHLPWRALVYRSL
NTFVDDVASFLIDMPWMHRLSCFRDDIIFICYLYQRWIYKVDKSRTLGAAPAPTAELQQLHRDDDLQQPGSEEKNEEETR
AKEDGNESPTASASALAGASRSSGKTPGAACKRNYRPQETPTDVM

Gene-Specific Links for TGME49_005240

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins