ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_005220 ()

U5 snRNP-associated 102 kDa protein, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_11977

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PF11_0108 U5 snRNP-associated protein, putative
  • PBANKA_093740 U5 snRNP-associated protein, putative
  • PY03704 putative pre-mRNA splicing factor
  • PVX_091160 U5 snRNP-associated 102 kDa protein, putative
  • PCHAS_090690 U5 snRNP-associated protein, putative
  • PKH_090750 PRP1 splicing factor, putative
  • TGME49_005220 U5 snRNP-associated 102 kDa protein, putative
  • NCLIV_020440 U5 snRNP-associated 102 kDa protein, putative
  • cgd5_920 Pre-mRNA splicing factor Pro1/Prp6. HAT repeat protein
  • Chro.50295 pre-mRNA splicing factor
  • CMU_040980 pre-mRNA-plicing factor 6, putative
  • TP01_0797 hypothetical protein, conserved
  • TA05710 pre-mRNA splicing factor (U5 snRNP-associated), putative
  • BBOV_IV009720 u5 snRNP-associated subunit, putaitve
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_005220 U5 snRNP-associated 102 kDa protein, putative
MQAPRQPASLMPGARRFMPGVGSGPSGPYVAGVGRGATPFSTRAETPGLHSVPGRRTDNLMNKAALQASAGVMVGGELSS
SARTAAELFGRPPPGYIPGRGRGATGFAGGVSRDDTATDNVHDKSDLSDANFDPFTGYSEALFNDAEYDEEDKEADRIYD
TVDMRMDARRKSRRENRLKEEIAKMRAEKPTIHQQFADLKRSLATVTKEEWEAIPSVGDYTLKRKQKKPQMFSMAPDSLL
LQGRNSTSYSNSIASAGSATPIGFGMQTPLMGMATPLGLQTPLGLRTPLLGSGSGTGSSGAGTPSLNDLGEARGTVLSVK
LDKVMDNLSGQTVIDPKGYLTDLNSMQLQSDADVADIKKARTLLKSVTATNPHHAPGWIAAARLEELAGKLQAARELIAT
GCQQCPKSEDVWLEAARLEKPANAKAVLAKAVSVLPHSVRLWFDAYAREKDLDQRKRVLRKALEFIPNSVRLWKEAVSLE
EEKNARIMLTRAVECVPQSVEIWLALARLSSYEEAQKVLNEARKKCPTSPEIWVAACKLEETQGNLKMVDTIIARARDNL
IARGVAQTRDVWLRLAEEAEASGFMATCQAIVRATMKVGVEGMNAKRIWKEDAEEALSRGSVATARALYTCAIERLKTKK
SLWLALADLETKHGTTQDLEKLLAKAVVCCPQAEVLWLMLAKQHWLQGDVQAARKVLAEAFVHNENNEAISLAAVKLERE
NHEFARARKILKRTRAHVNTQKVWIQSVQLERQVGDYDAAIALCEEALKSHAECPKLWMIGGQLHREHPTKKDEEKAAEV
FQRGTVVCCRSVPLWLCAVDCQREQGKWSVARAILEKAKLRNPKNPDLWHAAIRIEVEAGNKQMAQHVASKAVQECPNSG
LVWAEAIFLEEKSAQTHKAVDALTKCENDVHLVLAVACLFWKEGKISKARKWLNRSVTLDASFGDAWAAFLAFELENGGG
EKECRNIINKASLAQPNRGQICRQS

Gene-Specific Links for TGME49_005220

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins