ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_004530 (MIC11)

microneme protein MIC11, a gene from Toxoplasma gondii

Compiled localisation
microneme during tachyzoite

Who localised this protein by microscopy?

Harper, J. M., Zhou, X. W., Pszenny, V., Kafsack, B. F., Carruthers, V. B.
The novel coccidian micronemal protein MIC11 undergoes proteolytic maturation by sequential cleavage to remove an internal propeptide. (2004 Aug, Int J Parasitol) PubMed / full text
   more detail about this publication

microneme during tachyzoite
  • "Dual staining immunofluorescence confirmed that TgMIC11 localises to the apical micronemes"
  • Microscopy type: Light
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AF539702, annotation matches
  • Localisation record: microneme during tachyzoite
  • Other genes localised in this publication: microneme TgMIC5 protein, MIC2-associated protein M2AP

Orthology

OrthoMCL

Part of OrthoMCL group OG4_114703

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_004530 microneme protein MIC11
MQLKKLSVVSITLLGLFKFVNGVSEGVVVPVRFGSETARADLLNQVSETVFSLVETTEDDKSAASIVRGAFRSALKEILV
AVKGEAVDDESDFSFLDSPKTSEASIRPHGFLQERKFVDTLKTLAKGALKTFVEPMKAALVDGIRPMLPKIKEVAIDVFR
QACEHAEEKLQDA

Gene-Specific Links for TGME49_004530

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins