ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_004340 ()

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
microneme

Who localised this protein by microscopy?

Orthology

OrthoMCL

This gene does not have an OrthoMCL group.

Amino Acid Sequence

>TGME49_004340 hypothetical protein
MKPSSLRILLVAWTIISDAELNHFSSQAPLSWPRCVVVSAADDAQRDRGDTTAASSSRDEELEAAGPADEAKKAAGENAR
ECAGTCNEPPDGSVHVRSSDGSEYLDEQPGDGAGQIVEQPRSDEAEGSESQASVGGRYYEQEASDGKRHDEEEPPDRRGY
VEKAAVSDDGDAVRPTVVEGEDQELLLKPIGKGKACERVIVSRIRDGGVKRGKKMGFNAVGINMPMWSCYGMSVSEAGSG
FPRDWMASLSRRNILNVVNEEALLRKAKNRIGIELAWESGEGGEKPYMKCEEGGLYVPVIVTNVEDQEPYRVELSPTKFW
SAASSRTGRLYVIPEQEASVTEGDKEDEKSVYIIPMEALEGHVFLPHGYLKGHYSEMPNELNHAREFEVNKLSVDDFLTR
GQRVTLVCTAPGEPARIVPTVDAAPRTLQVSRRKDKREGEIRGQTPPKENAAADAAIQEADGNKLSRDRVTPQGLTEQES
RTVGKTEETDTAASRSAELTGATRGLVLMFLTEEDGLGFELPLPVLVDRVLFMVKQTQEAAPLHLLAYLTVRPCKRPIHD
PIFGQSYEPVQETTVKNRMGGGGEGSGKESGGFFGFFKQQTQKPKDFEAQESREDMSKRCRPKRVLPVELIGTEALQSPT
LLNAMLEQIESRLKSDTQCIVAAAPATPKSDSPNRPRLRARLVCPSLEHLFILLREKDASDREYNAFKRTKNRQMIKGAV
VGLFGLFLAYRGLVGLTRNPMMARELFAHVIGREHVGNQPYHFFPSERQLYRFVGLRSLGRALQFRRYNEAMGNAGVRAQ
VGISLWTVSLLALTALLAIRLGRGTRHFVRNRKRVSNIKGELQRRPIIHEEQAPVPELEEAEDECSTVDVTYLSFLY

Gene-Specific Links for TGME49_004340

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins