ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_004130 (PLP1)

membrane-attack complex / perforin domain-containing protein, a gene from Toxoplasma gondii

Compiled localisation
microneme during intracellular tachyzoite

Who localised this protein by microscopy?

Kafsack, B. F., Pena, J. D., Coppens, I., Ravindran, S., Boothroyd, J. C., Carruthers, V. B.
Rapid membrane disruption by a perforin-like protein facilitates parasite exit from host cells. (2009 Jan 23, Science) PubMed / full text
   more detail about this publication

microneme during intracellular tachyzoite
  • "TgPLP1 localizes to micronemes (Fig. 1A), which are apical secretory organelles important for parasites' gliding motility and invasion, and is secreted in a calcium-dependent manner similar to other microneme proteins (Fig. 1B)."
  • Microscopy type: Light
  • Microscopy method: HA tag
  • Strain: 2F
  • Gene model mapping comments: Blast from EF102772, annotation matches
  • Localisation record: microneme during intracellular tachyzoite
  • Other genes localised in this publication: -

Huynh, M. H., Carruthers, V. B.
Tagging of endogenous genes in a Toxoplasma gondii strain lacking Ku80. (2009 Apr, Eukaryot Cell) PubMed / full text
   more detail about this publication

microneme

Orthology

OrthoMCL

Part of OrthoMCL group OG4_21677

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_004130 membrane-attack complex / perforin domain-containing protein
MLLSAIGGIGPTESRLQHIPFSTTRYLPIRSHVLQSTVERIESPEALNEVPTKVERNEFTEKGDKTEQVLTAQADHKSLL
EGRSVRLESTSTAPDDDFDFLFEDDTPKKPKSRVNKGTSSDETSPGDRSSGEGSSDSDSLLSVVHRTKGNATQANKNQTR
ITHPKSKAQHQKKVTKKQGIPGSDSLGTSSADFDFDIDSSSNTQADDSQRQSLGDSSALDLFGSDTGDTGDIFGFSNSSS
DGGNAAANDGGLFSSSGMGPTGASDETSANPLGSILGGVLNPFAQQQSITPMTDKADEWSKENMKAFEEKMPKKMRDDGS
PDSWYKQAVPQESVADLNRMRENRRIAEENRAAAPLSAVYTKATKTVPAINYLGAGYDHVRGNPVGDPSSMGDPGIRPPV
LRFTYAQNEDGVSNDLTVLQPLGGYVRQYVACRQSETISELSNLSDYQNELSVDASLQGGDPIGLNSFSASTGYRDFAKE
VSKKDTRTYMLKNYCMRYEAGVAQSNHFKWNVTIAFAAGVSQLPDVFDAHNPECACSAEQWRQDQNAEACTKTNVPIWIS
FIEQFGTHFLVRLFAGGKMTYQVTAKRSEVEKMRNMGIDVKTQLKMQLGGVSGGAGQGTSSKKNQSSSEYQMNVQKETLV
IGGRPPGNVSDPAALAAWADTVEELPMPVKFEVQPLYHLLPVEKQEAFKQAVTFYSKSVGLTPQDLSALTGVTRNLPKQL
TQATQVAWSGPPPGFAKCPEGQVVILGFAMHLNFKEPGTDNFRIISCPPGREKCDGVGTASSETDEGRIYILCGEEPINE
IQQVVAESPAHAGASVLEASCPDETVVVGGFGISVRGGSDGLDSFSIESCTTGQTICTKAPTRGSEKNFLWMMCVDKQYP
GLRELVNVAELGSHGNANKRAVNSDGNVDVKCPANSSIVLGYVMEAHTNLQFVRDKFLQCPENASECKMTGKGVDHGMLW
LFDRHALFGWIICKTVNEPAMHVATDVGKAKGNGKKRKGKKGKNKTNAPNEVEEGQQLGADSPSQVSVPADADSGPTSKT
MSSLKLAPVKLLDL

Gene-Specific Links for TGME49_004130

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins