ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_004050 (SUB1)

subtilase family serine protease, putative, a gene from Toxoplasma gondii

Compiled localisation
microneme and not dense granule and not rhoptry during extracellular tachyzoite

Who localised this protein by microscopy?

Miller, S. A., Binder, E. M., Blackman, M. J., Carruthers, V. B., Kim, K.
A conserved subtilisin-like protein TgSUB1 in microneme organelles of Toxoplasma gondii. (2001 Nov 30, J Biol Chem) PubMed / full text
   more detail about this publication

microneme and not dense granule and not rhoptry during extracellular tachyzoite
  • "TgSUB1 localizes to micronemes."
  • Microscopy type: EM
  • Microscopy method: polyclonal antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from AAK94670, annotation matches
  • Localisation record: microneme and not rhoptry and not dense granule during extracellular tachyzoite
  • Other genes localised in this publication: microneme protein 2

Orthology

OrthoMCL

Part of OrthoMCL group OG4_18226

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_004050 subtilase family serine protease, putative
MGSSHAIVACAALIVLLSTNARGLRVRKDKDVLLATSFLSHHGEYQNPTGTYNLIKEIRRVEAEIEDEVETLNRDRRLHR
GHNKYADDDIRQGLKGEQDMGASENIPVAELEPQDLDREAKYPVRMLIVDKRSDDDDEETKTSFVETALHSDLAQRVVKE
LNGHVDVLRESGVVLVDLPAQTTDKQLQELIETARAQGTIVEPDHLVQSVNTSSKGSNDPLLDRLWGMDALNVKEAWDII
TTGEPNMGGRRPLVCVLDTGIDYNHPDLRDNMEVNQAERDGTLGVDDDNNGEVDDIYGANMLSKENDPADDHSHGTHVAG
TIGAHGNNGIGVAGVAWAPRLLPCKFLAYTGRGYSSDAVRCIDYCVKRGADIVNHSWGGSWPSEALREAVVRTANNGLIH
IFAAGNDGVDIDQTAFYPAAFSTEADGLITVANVKGDPDHGGKRIIELDRSSNYGIQRVQVACPGMWILSTVPTSGSSQE
PYAEKSGTSMAAPALSGIVALMLAVNPGLSTRQVREGLRQCSVQQPLLQGKVEWGSMPDAKRCVEYALTTHAEGRHKSFI
REPSTETSTPPPPPPAQPTPQPQPHPPPQPETPPCAPSPPPPTPPCAPSPSPPTPPPGSPHKPEPQTPVYPEVPRSTRSP
PPSPPPTESAPEAPPSDTPSCRVPPCSSSPRSGSQPKPPQDNTTTPKMPSLSSPPTEHSTAQPPKHENDAREQEPPTDED
DFSSVKGKKLGAYESDGSPRASSCAGAGVLGVFFMVVGLTV

Gene-Specific Links for TGME49_004050

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins