ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_003970 ()

dolichyl-di-phosphooligosaccharide-protein glycotransferase, putative, a gene from Toxoplasma gondii

Compiled localisation

Who localised this protein by microscopy?

No manually curated localisations are recorded in ApiLoc, sorry.

Orthology

OrthoMCL

Part of OrthoMCL group OG4_12332

Localised Genes in this Group
    No apicomplexan genes in this OrthoMCL group have been localised.
Other Apicomplexan Genes in this Group
  • PFI0960w dolichyl-diphosphooligosaccharide-protein glycosyltransferase, putative
  • PBANKA_082050 dolichyl-diphosphooligosaccharide--protein- glycosyltransferase, putative
  • PY05331 hypothetical protein
  • PVX_099395 dolichyl-diphosphooligosaccharide--protein- glycot ransferase,putative
  • PCHAS_082080 dolichyl-diphosphooligosaccharide--protein- glycosyltransferase, putative
  • PKH_071680 dolichyl-diphosphooligosaccharide--protein-glyc ot ransferase,putative
  • TGME49_003970 dolichyl-di-phosphooligosaccharide-protein glycotransferase, putative
  • NCLIV_021120 dolichyl-di-phosphooligosaccharide-protein glycotransferase, putative
  • cgd2_1650 dolichyl-diphosphooligosaccharide-protein glycosyltransferase beta subunit (Wbp1p)
  • Chro.20179 dolichyl-di-phosphooligosaccharide-protein glycotransferase (oligosaccharyltransferase)-related
  • CMU_013170 dolichyl-diphosphooligosaccharide--protein glycotransferase, putative
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms

Amino Acid Sequence

>TGME49_003970 dolichyl-di-phosphooligosaccharide-protein glycotransferase, putative
MVSPADGATPFRPLPFGGASSVDSTGPARSAPDHQPLSLSPCWLLSSRVFSRWSPGRLFMLLSLLCFLHAWQSRPREDSL
DLRLDKETLEAPLLRAHAAVLPIPSAPPLRASPQGPTPVVCGSVQKRLLVLHDDPNVKENFKSLLQRLKDQNFDISTVSF
PLSSGRKASLLFSHHGEHLFTHVLLLATNHRSLSRELAAALTTFFTAVDPDFEEAQAARAYAAASASSAGADACPQALKA
RNLFLVVSPTAHTTVHAFVETLMGVREARGTEGSNGRPGLVADFFNAYSPLQGTLEKKDAAGQSDENGDASLFVAMNLLA
DQPHVVEPLEAETAFVLPASGETPASLGKGDRKSGGEDESLLLGAELSLGSALQTQSGGRATLLSSGEFCSDKFSRLGSE
KNIEDGKKKIANLRVCEELLLWTFNRRGVLRWSNLKHFKPGETVSPHMYRMKDDIVFSVDLHQLENGLWHPFYATDVQVE
FVMLEPFLRFFLEPPASRQSPTFSRVFQAPDRYGVFKFVLHYNRIGFSPLHVESLAPVRNFKHNDFPRFLPCALPYYGCS
LLTLIGLIVFAVLFLLHRDKRFFSPPAAPSSETPGENIQRTQLKKKEETKVA

Gene-Specific Links for TGME49_003970

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins