ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_003710 (AP2VIIa-4)

hypothetical protein, a gene from Toxoplasma gondii

Compiled localisation
nucleus during g1 phase of intracellular tachyzoite and s phase of intracellular tachyzoite
during not mitosis of intracellular tachyzoite

Who localised this protein by microscopy?

Behnke, M. S., Wootton, J. C., Lehmann, M. M., Radke, J. B., Lucas, O., Nawas, J., Sibley, L. D., White, M. W.
Coordinated progression through two subtranscriptomes underlies the tachyzoite cycle of Toxoplasma gondii. (2010, PLoS One) PubMed / full text
   more detail about this publication

nucleus during g1 phase of intracellular tachyzoite and s phase of intracellular tachyzoite, during not mitosis of intracellular tachyzoite
  • "All tagged AP2 proteins were localized to the parasite nucleus."
  • Microscopy type: fixed light
  • Microscopy method: antibody to YFP tag
  • Strain: RH Ku80-
  • Gene model mapping comments: Taken directly from publication
  • Localisation record: nucleus during G1 phase of intracellular tachyzoite and S phase of intracellular tachyzoite, not during mitosis of intracellular tachyzoite
  • Other genes localised in this publication: malaria antigen, putative, hypothetical protein, hypothetical protein, hypothetical protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_114730

Localised Genes in this Group
Other Apicomplexan Genes in this Group
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_003710 hypothetical protein
MQETSPAHRERHALRLQLVPDQLSPSLEDASSTSHPSCAAPSDRDVSSCVVSRQNIRNDSTEGVTVVSPHLRRCLTEYDE
YIDFLPASVMDVSSPSQRSGGAERDDAKLEGLTGPGNNGDRDSLSRWPAKLTTSLSSAFVQRRGVTRPGSDLVSPLFSSF
LADGRHGSRNEVDSAGFGAGEGEQGAKQCPPLLTTKQEGRLEMDDGNGEPLEAQCGSGRPRVLTADAFPPSQRLSRSTSL
DSSLASSRKCRAQLLRATDALCMRSPLFTRNDSPLFSRVPSMSLTTGGRSELKLGASEPGSSEERKSEKEYGTQLDKETG
DSSMEDEVVSGLEGDREVSGRTLLQPDFHTRLQAALREQEECRAPGLRLLRQQEMREQGDMEAEPVLAPSHSRGGDDEGR
VGPGVGRLNGAGRRRGKNKGAARLPHLFRVGGADSDAREGILNAVVAKSSDGGERTAGDVEMEADGEHQCDWAMKAAGAE
DVAALLAPGHRESREGEDRGEKAKATTDAQQLPEDAVIRMLSLSVELDIMGVNSCAVGSAEDVARMTRWRADLDDESDSS
VSIRKNGVENGASASGVASELKDREILATRCDDKDQVVTRVTEKNAQRHTIIEDLGTTDGPRTTRMVVQHGDDDSSPRES
SAVLRLDDVSLPLYPIGQTMDCSPSTPTSSPIACCSRFARQLVFSASRSPRARPFFFGSHHTVSGPTSCPSSAFAPTFAT
GSRGALANAQDEKDEERRESHALMCALGNINEEESGEEPQNRVCAIDATAGVGVDGVSDNARETGKKSEVDDSEERCVSM
PLFQRKKASPFCHEGELLLASPLAPPHPDILTPRSAGNACGARLLLGPAPGCGVSPSPQHPPITDISPGAVCGEIERDFA
RGAGVGAATWASSCRCFLPEDSLSLFLEIRSTLLNLLEELHDACCCCHPASSLKALRPPGLEPLCPHALAAEVSPSSSET
VASPVGTGEFFREAVSRGDSTPPGLCGGDSATLEKVVFKKDELKEDVSSVVDEASPVEQERDEKEKKIPGVRVSIGSNVC
AFRVDGKQNLDIRDECPDSQKKSALRAKATTTVSTTVSAITPACTPTASGCFVDSHCGVSIVTGIPVCGVPSIEDSRSES
PVGPDVEVKRLSGVPPSPTGIDETVESTANTGLIGMSESGFAKTAEAVAAQKKAMSGEIERAGDSDRLSRVADGLLSGQQ
TREGFEEEERASISSGATRCPGTGDKNAGLGGRCSLDTPAASPSSSVSVASPDAYSFSPFTRSGVGAESPGENQNALSAS
SSPALLTSSTRHPPLPSSLHRVPGVVSPFASSSSLSVCSSTPMSQGGVLPRCGPALHALFFEHVDCLRSSRCFVEQLAYA
HIFRMCLQTLGGGRPSSLSPLQQQFLVRELFLLRQEPNRLLVRNAFMWTGQPGCRHILDQLCGSSVSLSAGMITSKNPFA
MDRDKLGAAGHATQHGAYGWGGLHGMGNGDGSSPGFPGGFFGFEKSSSNWEFSGQHGFDDLRKNGSHAGQSRISTRGQSA
LAAATATSSGEQARVECIGGVDDGTGKEAGYSTGTRKGRTFGDQEESDDREGGGKADQKGDAAASSDINSPVAASPAKAL
LDPSIFLCTADMEVGAQKSALVASLRALRSLAPSWASQPEGGFAFHLQQLLQARSLHSQTLQNYRVILQELFSVPPRLWG
KERLLDALHDLDCLYSVTKRRAEARQKRVEEMLRTSRENADSEAQDMIRRDDEGNESSHLSGAGEGQENRAESVRVLQQA
SRLGQTGEGGSGGRRVVIDDARLPKVFGSGSYAPEDSVASRSQEKPDFLSEADDVHSADSFFKGSRRREDTDSRDPMTRH
HLQSERDEHSLLNSEELHFRQGRSVCIGGKSSSSFDAAESLGTHRGDSSDLEDPSICAKGWPSTTGESDTQALQQVLEEQ
LRRQGLSAHNVGATLAQVLRSGGTDAALKALQRLLAPSRQSQGAHAGGLSRDNRVGAMERSQKQLLRQLIQGATSMSPSL
GSSWEANGVSLAYASKLRGVSSQRGGREGDEQEPIPLLGTSKQRGLERSGASPARSGSGMPTDEERLGTEVTERGNASRR
GKPHYSESSSKRMKTEGGHLRRHDASLSLAVGDDELQALSALPSPNDQALGSSRAHTRHSPLSRQSHFPSPSAAGLNGNQ
KLGVSGHCSSRRHEAKEMAAGEGRGKSYAWSAAGNGREGGVGSRGSGTGRESGSGGQKEEQAERLEYARRAATLEKVKGV
FIGKKNTCWVAQWTDSSASAQVAGGPRDTDELIALRNEDQKVTGGPGRRQTMSSSPGSVSPTMFPTDGLPSRQNGNSAGT
ANGTTAMANDALLSAVVHATANALNGVGVSSNAEGNSVRSSLSPTSLAADILAQLQSASRGLSPSPSDRRKRSVDLLRSL
SGSPVLGASSTAPPLPSALSPSSPDGAASTMVPSAGLISGGESGRLPVLAAQGPESPLYSPASSCEDPSRAMAQHSTPGG
FVHASSGGAPQGPSSPSVEASHDLSSPSLIKDAAGESEQEMKRMTLDEKSGADATRPTTVDLHAARNVCTSPGMASSSFS
LSESSPLVAPSLPKSETGVSSNVPSLASLSAALSQAFPNLASAMSVPTSNKVPRTDSLSSVSPEHLQLFQQLAEQFLPSQ
QRLQPPRNSHGSAASIGSASSLSLINPHVEMSSVSRNSPIFGNTVDPGVLSGVAELSTAISQTVRSGDLAANVGNRHLAS
STHLSSSLSQLHSTNLPSVNSFSTEPPLSRASSGCTSASALPSMSLHSTNPRLASPSTSPFQAPSSEAGSSMNSASSATR
RESSAVPSHPSSPATKLSFLLGGHAQGASGQMVDVFSRQSSGTAPRGPEDAYAVFAGPNAGRGRRHRMAYTHKQGRRTYA
SQARDFPRVEGIEYNVKCACWEVRCGASFKVFSTRRLGGLQEAYDLAVKWKQEVEGGSGGNGCRRLVSDRRLARNAGTVS
QNMMMFLGNDGSGGPRVSGGDEDGEADEEADHEEGCPYPGESDAGNSLKRGSRSGSSKEDQEDDDRLRVLQHTEWGAGNR
VENPAVDRNARALAYDLWMRSGGSPSCEDGAPAPAMSLGEAALATQRPQGDVDMLTSLLEQLSKTNGTAGSGSVSSLQED
SQAAPEDICGALTLLAGAVNGQSTDIGKQGSLGDVLTGDVAHDLRRLLRPEPDENARGSAVNRDTMVRGVKDGGQAHENG
DDPSPGELRGNGGRDSAQHMEEHKKRSREYDGHNDPENRLINAIFAAASSSKKARTD

Gene-Specific Links for TGME49_003710

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins