ApiLoc - A database of published protein sub-cellular localisation in Apicomplexa

version 3 (curated until May 28, 2011)

TGME49_003310 (GRA7)

dense granule protein 7, a gene from Toxoplasma gondii

Compiled localisation
dense granule during bradyzoite and extracellular tachyzoite and intracellular tachyzoite and mature schizont merozoite and merozoite and sporozoite and tachyzoite
parasitophorous vacuole during bradyzoite and early merozoite and sporozoite and tachyzoite
oocyst wall during bradyzoite
not parasitophorous vacuole during mature schizont merozoite

Who localised this protein by microscopy?

Rooney, P. J., Ayong, L., Tobin, C. M., Moreno, S. N., Knoll, L. J.
TgVTC2 is involved in polyphosphate accumulation in Toxoplasma gondii. (2011 Apr, Mol Biochem Parasitol) PubMed / full text
   more detail about this publication

dense granule during intracellular tachyzoite

Igarashi, M., Kano, F., Tamekuni, K., Kawasaki, P. M., Navarro, I. T., Vidotto, O., Vidotto, M. C., Machado, R. Z., Garcia, J. L.
Toxoplasma gondii: cloning, sequencing, expression, and antigenic characterization of ROP2, GRA5 and GRA7. (2008, Genet Mol Res) PubMed / full text
   more detail about this publication

dense granule during tachyzoite
  • "The present study cloned genes from two secretory organelles from T. gondii, dense granules and rhoptry. Analysis of sequence variation in the T. gondii rop2-, gra5- and gra7- coding regions from Londrina-RH strain showed some heterogeneity in nucleotides and predicted amino acid sequences (data not shown), when compared to the RH strains from the GenBank. However, this heterogeneity neither changed reactivity in the indirect fluorescence antibody test nor immunoblotting to T. gondii tachyzoites."
  • Microscopy type: Light
  • Microscopy method: antibody directly to protein
  • Strain: RH
  • Gene model mapping comments: Blast from Y13863, annotation matches
  • Localisation record: dense granule during tachyzoite
  • Other genes localised in this publication: Rhoptry kinase family protein ROP2A (incomplete catalytic triad), dense granule protein 5 precursor

Zhou, X. W., Kafsack, B. F., Cole, R. N., Beckett, P., Shen, R. F., Carruthers, V. B.
The opportunistic pathogen Toxoplasma gondii deploys a diverse legion of invasion and survival proteins. (2005 Oct 7, J Biol Chem) PubMed / full text
   more detail about this publication

dense granule during extracellular tachyzoite

Ferguson, D. J.
Use of molecular and ultrastructural markers to evaluate stage conversion of Toxoplasma gondii in both the intermediate and definitive host. (2004 Mar 9, Int J Parasitol) PubMed / full text
   more detail about this publication

parasitophorous vacuole during bradyzoite and early merozoite and sporozoite and tachyzoite, oocyst wall during bradyzoite, dense granule and not parasitophorous vacuole during mature schizont merozoite

Ferguson, D. J., Jacobs, D., Saman, E., Dubremetz, J. F., Wright, S. E.
In vivo expression and distribution of dense granule protein 7 (GRA7) in the exoenteric (tachyzoite, bradyzoite) and enteric (coccidian) forms of Toxoplasma gondii. (1999 Sep, Parasitology) PubMed / full text
   more detail about this publication

dense granule during bradyzoite and merozoite and sporozoite and tachyzoite, parasitophorous vacuole during tachyzoite
  • "There was strong staining of GRA7 in granules within all the infectious stages (tachyzoite, bradyzoite, merozoite and sporozoite). During tachyzoite development, GRA7 was secreted and was associated with the parasitophorous vacuole. In contrast, although there was staining of granules within the bradyzoites of more mature cysts, there appeared to be little staining of the tissue cyst wall or host cell."
  • Microscopy type: Light
  • Microscopy method: Monoclonal antibody directly to protein
  • Strain: M3, RRA
  • Gene model mapping comments: inferred from another publication
  • Localisation record: dense granule during tachyzoite and bradyzoite and merozoite and sporozoite, PV during tachyzoite
  • Other genes localised in this publication: nucleoside-triphosphatase I, hypothetical protein

Orthology

OrthoMCL

Part of OrthoMCL group OG4_114738

Localised Genes in this Group
Other Apicomplexan Genes in this Group
    There are no other apicomplexan genes.
Non-Apicomplexan Genes in this OrthoMCL Group with Gene Ontology 'Inferred from Direct Assay (IDA)' Cellular Component Terms
    There are no non-apicomplexan genes that have manually annotated evidence codes.

Amino Acid Sequence

>TGME49_003310 dense granule protein 7
MARHAIFFALCVLGLVAAALPQFATAATASDDELMSRIRNSDFFDGQAPVDSLRPTNAGVDSKGTDDHLTTSMDKASVES
QLPRREPLETEPDEQEEVHFRKRGVRSDAEVTDDNIYEEHTDRKVVPRKSEGKRSFKDLLKKLALPAVGMGASYFAADRI
LPELTEQQQTGEEPLTTGQNVSTVLGFAALAAAAAFLGMGLTRTYRHFSPRKNRSRQPALEQEVPESGKDGEDARQ

Gene-Specific Links for TGME49_003310

General Sub-Cellular Localisation Links

  • TargetP, prediction of signal peptides, as well as chloroplast and mitochondrial transit peptides
  • OrthoMCL, automatic clustering of orthologous groups of proteins